(data stored in ACNUC10821 zone)

EMBL: AE017262.PE371

AE017262.PE371       Location/Qualifiers
FT   CDS_pept        complement(397459..398985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0375"
FT                   /product="putative long-chain acyl-CoA synthetase"
FT                   /note="identified by similarity to GP:12723568; match to
FT                   protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03161"
FT                   /protein_id="AAT03161.1"
FT                   /translation="MTIKKYEPLNLYTNFKKSAERYPEMPIHFDEELVTFPELGLHTTY
FT                   KKCEEAIIQKAAHLHKFGVRKEEKVIVYKSAKFDSYILAVAISYIGAVPIMVSPHLPAS
FT                   TIDIFVNRLDQPWLLFDSETSEKSHQLNNLPDSRLINAEQLFKAPLDGYTCEQEELPKD
FT                   MIAYMTHTSGTTGVPKLIAHSANSMGWRTKYQRRILNFIKPRGLVAFHISPVHSRFNIG
FT                   VSSLMSLGFPLLPIANPTKANVEKVLREYKPYVLETHPNHFVQWASLAREKPDVFQSIK
FT                   FYHSTFDAINKETMAVFLRTSEYKKPIFLQIYGQSECGPMILRGHTLQSIETLNARDMG
FT                   IGVPGLTEVRIVDQDGNPVPAGVSGNIQMLSKGRALTYYKEEARFEENVYGPWWDSGDY
FT                   GMKDEQGRLFLQDRQVDLVETIDSTLAIEDKLLDTLTFLDEVVIIRGENGSPQPIIAVH
FT                   NDGEMNWDAWWKAVSDLPHMNEPMVMKYDEIPRTATMKVQRLQMERELKK"
     atgacgataa aaaagtacga accacttaac ctctatacca atttcaaaaa atctgctgaa        60
     cgctatccag aaatgcccat ccattttgat gaagagcttg ttacttttcc tgaattaggc       120
     cttcacacta cttacaaaaa atgcgaagag gctattatcc aaaaagcagc tcatctacat       180
     aaattcggtg tacgcaaaga agaaaaagta atcgtatata aatctgccaa attcgattct       240
     tatattttag cagttgcgat ttcttatatt ggtgccgtgc caatcatggt ttccccgcat       300
     cttccagcgt ctactattga tatttttgtt aatcgccttg accaaccttg gttacttttt       360
     gattctgaga cttctgagaa aagtcatcag ttaaacaatt taccagactc aagattgatc       420
     aatgctgaac aattgtttaa agcgccacta gatggctaca catgcgaaca agaagaatta       480
     ccaaaagata tgattgctta tatgactcac acttctggaa caactggtgt gccaaaatta       540
     atcgctcact ctgcgaattc gatgggttgg agaacgaaat accaacgacg tattcttaat       600
     ttcatcaaac caagagggct tgtagctttc catatctcac cagtacattc tcgttttaat       660
     attggtgttt catccttgat gtcgctcggt ttcccgcttc tgccaattgc caatccgact       720
     aaagcgaacg tcgaaaaagt gctacgcgaa tacaaaccgt acgtactcga aacgcatcca       780
     aatcattttg ttcaatgggc gtcacttgct cgtgaaaaac cagacgtttt ccaaagtatc       840
     aaattttatc attctacttt tgatgcgatt aataaagaaa caatggcggt tttccttcgt       900
     acttccgaat ataaaaaacc aattttctta caaatttatg gacaaagtga atgtggtccg       960
     atgattttac gtggtcatac gcttcaatcc attgaaacgc taaatgcgcg cgatatggga      1020
     attggtgttc ctggtttaac agaagttcgg attgttgacc aagatggtaa tcctgttcca      1080
     gctggggtta gtggtaatat tcaaatgctt tccaaaggtc gcgcgcttac ttattacaaa      1140
     gaagaagctc gttttgaaga gaatgtgtac ggaccttggt gggatagcgg cgattatggt      1200
     atgaaagatg agcaaggccg gttattcttg caagatcgtc aagtcgattt agtagagact      1260
     attgacagca cacttgcaat tgaagataaa ctgcttgata cgctgacttt cttagatgaa      1320
     gttgttatca tccgtggtga aaacggtagc ccgcaaccaa ttatcgcagt tcataacgac      1380
     ggcgaaatga actgggacgc atggtggaaa gctgtttctg acttgccaca tatgaacgaa      1440
     ccaatggtga tgaaatatga tgaaatccct cgtactgcaa caatgaaagt acaacgtttg      1500
     cagatggaac gagaattgaa aaaataa                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page