(data stored in ACNUC10821 zone)

EMBL: AE017262.PE373

AE017262.PE373       Location/Qualifiers
FT   CDS_pept        400946..401962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0377"
FT                   /product="oxidoreductase, YhhX family"
FT                   /note="identified by match to protein family HMM PF01408;
FT                   match to protein family HMM PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03163"
FT                   /protein_id="AAT03163.1"
FT                   /translation="MLKMGFIGNGKSTNRYHLPFILERDNIEVKTIYNRNPKTATWDKI
FT                   EGVHYTTDLDELLKDPEIQLITISTTQSSHFDYAKMVLENGKNVLVEKPFMMTYAEAKE
FT                   IFELAKEHGLLVQCYQNRRFDSDFLTAQKVIESGKLGDLLEVEMHYDYFRPEIPESVHE
FT                   FKFYDSYLYGHGCHTIDQVLSYFGKPDNIHYDVRQLLGEGRMNDYFDLDLYYGVTKVSV
FT                   KSSYFRIKARPSFVLYGKKGMFTKETKDRQEEHLKLFYMPSNPDFGIDLPEHYGTLTYV
FT                   DDAGVWHEEKVISEVGDYGRVYDGLYDAIINGKPKQVTDEETLLQMEILEKGVEACK"
     atgttgaaaa tgggttttat cggaaacgga aaaagtacga atagatatca tttaccattt        60
     attttagagc gggataatat tgaagtgaag acgatttata atcgaaatcc caaaacagcc       120
     acatgggaca aaattgaagg ggttcactat acaaccgact tagacgagct gttaaaagac       180
     ccagaaatcc agttaattac catctctaca acacaaagct ctcacttcga ctatgccaaa       240
     atggtgttag aaaacggcaa aaatgtgctt gttgaaaaac catttatgat gacatacgct       300
     gaagcgaaag aaattttcga actagctaaa gaacatggtt tactcgttca atgctaccaa       360
     aatcgtcgtt tcgattccga tttccttaca gcacaaaaag taattgaaag tggaaaatta       420
     ggcgatttat tggaagtaga aatgcattat gactatttcc gtccagaaat cccagagtcg       480
     gttcatgaat ttaaattcta cgacagttat ttatacggtc acggctgcca tacaatcgac       540
     caagtacttt cttacttcgg caaaccggac aacatccatt atgacgtgcg ccaactgctc       600
     ggcgaaggac gaatgaacga ttatttcgac cttgatttat attatggcgt aacaaaagta       660
     tccgtaaaat caagctattt ccgtataaaa gcccgtccaa gctttgtcct ttacggcaaa       720
     aaaggtatgt ttacaaaaga aacaaaagac cgccaagaag aacatttaaa actattttac       780
     atgccaagta atccagactt tggaatcgat ttaccagagc attacggaac gcttacgtat       840
     gttgatgatg ccggagtttg gcatgaggag aaagtaatct ctgaggttgg cgactacggc       900
     cgcgtttatg atggtttgta tgatgcaatt attaacggga aaccaaaaca agtaactgac       960
     gaagaaacct tgctacaaat ggagatttta gaaaaaggcg tcgaagcttg taaataa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page