(data stored in ACNUC10821 zone)

EMBL: AE017262.PE374

AE017262.PE374       Location/Qualifiers
FT   CDS_pept        404018..404878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0379"
FT                   /product="fructose-bisphosphate aldolase, class II family"
FT                   /note="identified by match to protein family HMM PF01116;
FT                   match to protein family HMM TIGR00167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03164"
FT                   /protein_id="AAT03164.1"
FT                   /translation="MLYTMKDLLAVGKEHQFAVPAFNICSFDMLKAIMEEVEANNAPVI
FT                   LEIHPDEIEYLGDNFVATVREYAHKSKVPVVIHMDHGGTIKDVMRAIRNGYTSVMIDAS
FT                   RASYEENVALTKQVVELAHKVGVSVEAELGTIGNNGSAEGGADTIIYTDPDQAEDFVQR
FT                   TGIDTLAVAIGTAHGLYPKDKKPELNMPLLKELNKRLDIPFVLHGGSGNPDKEVSESVQ
FT                   YGVRKVNLSSDLKSVFFEEVRRVLVDNPAMYEPNQVYPSANEKVKEVVRHKLHILNTTG
FT                   QRDKY"
     atgttatata caatgaaaga tcttttagca gtaggaaaag agcatcaatt tgcggtacca        60
     gcatttaata tctgtagttt tgatatgtta aaggcgataa tggaggaagt ggaggcaaat       120
     aatgctcctg taattttaga aattcatccg gatgaaatag agtatctcgg tgataacttt       180
     gttgcaacag tcagagaata cgcacataaa agtaaggtgc cggtcgttat tcatatggac       240
     cacggtggaa caatcaaaga tgtgatgcgg gcaattagaa atggctatac ttctgtcatg       300
     attgatgctt caagagccag ttatgaagag aacgtggcgt tgactaagca agtggttgaa       360
     cttgcgcata aagtcggtgt ttctgttgaa gcggaacttg gaacaatcgg gaacaatggt       420
     tcagcagaag gcggggcgga taccatcata tatactgacc ctgaccaagc agaagatttc       480
     gtacagagaa ctggcattga tacgctagcc gtagctattg gaacggcgca tgggttatac       540
     cctaaagata aaaaaccaga actgaatatg cctcttttaa aagaattaaa taaacgcttg       600
     gatattccgt ttgtacttca tggtggttcg ggaaatccag ataaagaagt cagtgaatct       660
     gtacagtacg gtgttaggaa agtaaacctt agttcagatc tgaaaagtgt gttttttgaa       720
     gaagttcgcc gcgttttagt ggacaatcct gcgatgtatg aaccaaatca agtgtaccca       780
     tcagcaaatg aaaaagtaaa agaagttgta agacataaat tacacatttt aaatactact       840
     ggtcaaagag ataaatacta a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page