(data stored in ACNUC10821 zone)

EMBL: AE017262.PE375

AE017262.PE375       Location/Qualifiers
FT   CDS_pept        404935..405705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0380"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03165"
FT                   /protein_id="AAT03165.1"
FT                   /translation="MLSTAKERQLKIVNRLKVEQFMRIIDLVELVNYSEATVKRDLVEL
FT                   EKEGLVRRTRGGAMIIDNKKIDLPYLMKMNERSNETSKIRIADIAKSLIRDDMVIFLDS
FT                   SSTSLHLIDVLSKFDGLQIITNGVMTASMLSEFTNARVSILGGSILTKRYTVNGAKAYN
FT                   DALTYNADIAFVSCRGIDYDKGATETHEGEALIKQAFRRQSSSLVLLVTEEKVGHKFMH
FT                   QSLACHDIDYLITDFKLDPDVEEQFKTHQITCLY"
     atgttaagca cagcgaagga acggcaacta aaaatcgtta accggctaaa agtggaacaa        60
     tttatgcgga ttattgattt agtggagctt gtcaactaca gcgaagccac tgttaaacgg       120
     gatttagtag aattagaaaa agaaggactt gtgagacgaa caagaggcgg cgcaatgatt       180
     atcgataata aaaaaatcga tttgccttat ttaatgaaaa tgaatgagcg aagtaatgaa       240
     acgagtaaaa taagaattgc cgatattgca aaatcactga ttcgcgatga tatggtgatt       300
     ttcttagact ctagctcaac atcactgcat ttaatcgacg ttttaagtaa atttgatgga       360
     ctgcaaatta ttacaaacgg ggtcatgacg gcttccatgc tatcagaatt tacaaatgca       420
     agagttagta ttttaggagg atcgatttta acgaagcgat atacggtgaa cggcgcaaaa       480
     gcatacaatg acgctttaac ttataatgcg gatattgctt ttgtttcatg ccgggggatc       540
     gactatgaca aaggtgcaac ggaaacacat gaaggtgaag cactcatcaa acaagctttc       600
     aggcgccagt caagttcgct cgttttactt gtcaccgaag aaaaagtagg acacaagttt       660
     atgcaccaaa gcttagcatg tcatgatatt gactatttaa ttacggactt caaactggac       720
     ccagatgtag aggaacagtt caaaacccat caaattactt gtttgtatta g                771
//

If you have problems or comments...

PBIL Back to PBIL home page