(data stored in ACNUC10821 zone)

EMBL: AE017262.PE376

AE017262.PE376       Location/Qualifiers
FT   CDS_pept        complement(405689..405916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0381"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03166"
FT                   /protein_id="AAT03166.1"
FT                   /translation="MYKIFSFVSLILSMLCFMGLQVLNVIQKNVILLSLLDSEEFNDIH
FT                   FFGSLLVIPVLFLVLTIIFAYLSIKSNTNK"
     atgtacaaaa tttttagttt cgtttcatta atacttagta tgctatgttt tatgggctta        60
     caagttttaa atgtcattca aaaaaatgtc atattattat cactattaga tagcgaagaa       120
     tttaatgaca ttcacttttt cggaagttta ttggtaatac ctgttttatt tttagtactt       180
     acgattattt ttgcctattt aagtataaaa tctaatacaa acaagtaa                    228
//

If you have problems or comments...

PBIL Back to PBIL home page