(data stored in ACNUC10821 zone)

EMBL: AE017262.PE380

AE017262.PE380       Location/Qualifiers
FT   CDS_pept        408331..409050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0385"
FT                   /product="conserved hypothetical protein TIGR01033"
FT                   /note="identified by similarity to OMNI:NTL01LI0386; match
FT                   to protein family HMM PF01709; match to protein family HMM
FT                   TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03170"
FT                   /db_xref="GOA:Q723U1"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723U1"
FT                   /protein_id="AAT03170.1"
FT                   /translation="MGRKWANIKEKKASKDKTNSRIYAKFGIEIYVAAKSGDPDPHANQ
FT                   KLRFVIERAKTYNVPKHIIDRAIEKAKGTGDETYSELRYEGFGPNGSMIIVDALTNNVN
FT                   RTASDVRAAYSKNGGNMGVSGSVAYMFDNTAIFGVEGKDADELLELLMEVDIDVRDILD
FT                   EDGQAIIYAEPEDFHKVQEGLKAAGIEEFTVAEIEMIPQNDIQLSGEDLEKFEKLIDAL
FT                   EDLEDVQKVYHNVELED"
     atgggccgta aatgggcaaa tattaaagag aaaaaagcgt caaaagataa aacaaatagt        60
     cgtatctatg caaaatttgg aattgaaata tatgtagcgg ctaaatcggg cgacccagat       120
     ccgcatgcca accaaaaatt acgttttgtt attgaacgtg caaaaacata caatgtgccg       180
     aaacatatta ttgaccgtgc aatcgaaaaa gcgaaaggca ctggcgatga aacatattca       240
     gaactgcgct atgaaggctt tggtccaaat ggttcgatga ttatcgtaga cgcactgaca       300
     aataatgtga atcgtacggc atccgatgtt cgcgcagctt atagcaaaaa cggcggcaac       360
     atgggcgtaa gtggttcagt agcttatatg tttgataata cagccatttt tggtgttgaa       420
     ggaaaagacg cggatgagtt attagaactt ttaatggaag tggatattga tgttcgtgat       480
     attttagacg aagatggcca agcgattatt tatgcagaac cagaagattt ccacaaagta       540
     caagaaggtt tgaaagcggc tggaattgaa gaatttacag tagcggaaat cgaaatgatt       600
     cctcaaaatg atattcaatt atcaggtgag gacttagaaa aattcgagaa actaattgat       660
     gctttagaag acctagaaga cgtgcaaaaa gtatatcata acgtcgaatt agaagattaa       720
//

If you have problems or comments...

PBIL Back to PBIL home page