(data stored in ACNUC10821 zone)

EMBL: AE017262.PE382

AE017262.PE382       Location/Qualifiers
FT   CDS_pept        complement(409462..410175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0387"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03172"
FT                   /protein_id="AAT03172.1"
FT                   /translation="MSGMAKYMEIYIDIRDKINQNKYEINEKLPDGDSMARTYDCSKLT
FT                   VKKALDMLVQEGMIIRRRGAGTFVKSHSTNGGEFALGPMSGLVNTFGKDNIKSKVILFS
FT                   IEKPSKEVAEKLEMQDDYIYRIIRMREVGHKAYSIEHTYMPLAIIPGLEPRHLEDSIYN
FT                   YIRDDLKLKMQSAHVWVRGDKSNQEDSKLLNLEEPTFMMEIEKLAHLEDGRVFEYSITR
FT                   HTYESFVFETVFVQN"
     atgtcgggaa tggctaaata catggaaata tacatagata tccgtgataa aatcaaccaa        60
     aataaatacg aaattaacga gaaattgcct gatggggaca gtatggctcg cacgtatgat       120
     tgcagcaagc tcactgtcaa aaaagcactg gatatgcttg tacaagaagg catgattatt       180
     agacgacgcg gggctgggac tttcgtgaaa tcccattcga ctaacggcgg agaattcgcg       240
     cttgggccaa tgtccggact tgtaaataca tttggaaaag acaatattaa atccaaagtc       300
     attttatttt ctattgaaaa accatcgaaa gaagtcgcag agaaattaga gatgcaggat       360
     gactatattt accgaatcat ccggatgaga gaagttggtc ataaagccta ttcgattgaa       420
     catacttata tgccacttgc gattattcca ggtctagaac cacgtcattt agaggactcg       480
     atttataatt atattcggga tgatttgaaa cttaagatgc agagtgcgca tgtttgggta       540
     cgcggggata aatcaaatca agaggatagc aagctcctca atttagaaga acctactttt       600
     atgatggaaa ttgaaaaatt agcgcatttg gaagatggtc gtgtgttcga atattcgata       660
     acgcgccata cgtatgaatc gtttgtgttt gaaacggttt ttgtgcagaa ttaa             714
//

If you have problems or comments...

PBIL Back to PBIL home page