(data stored in ACNUC10821 zone)

EMBL: AE017262.PE383

AE017262.PE383       Location/Qualifiers
FT   CDS_pept        410332..411774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0388"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /note="identified by match to protein family HMM PF00232"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03173"
FT                   /protein_id="AAT03173.1"
FT                   /translation="MKELLTFPKNFWWGSAWSAEQAEGRGDTGKAKTVWEHWFETEPNR
FT                   FYEGVGSEITTDHFNRYKEDVQWMKKTGQNSFRISISWARMFPNDGVGEVNPKAIAFYR
FT                   DLLTEMNENGIKPFANLYHFDMPVALQDAGGWESREVVDAYVHFADTCFKEFGDLVYHW
FT                   FTFNEPLGPILGGYLEDFHYPNQIDFKRGAQAGFNTILAHALAIKAFKKLNLSSKIGVI
FT                   LNLSPTYPRSQNEYDLEAAEICDAFYTRSFLDPMVKGTFPEKLVEIMREYDQMPEYTEE
FT                   DLTIIKENTAQILGLNYYEPRRVKARLTAINEKSPFLPDWFFEPHNMPGKRMNIYRGWE
FT                   IYERGIYDLCIDIRDNYGNIESFISENGMGVANEERFLNEEGQIQDDYRIQFVKDHLAY
FT                   VHQAIAEGCDIKGYHLWTFIDCWSWINAYKNRYGLVSLDVETGKRTMKKSGEFYKKMSD
FT                   MNGFEYDTSKLVGTKREETTNG"
     atgaaagaat tattaacgtt tccaaaaaat ttttggtggg gctctgcgtg gtctgctgaa        60
     caagcagaag gtcgcggcga cactggtaag gcaaaaactg tttgggagca ttggtttgaa       120
     acagaaccga atcgctttta cgaaggcgta ggttcagaaa ttacaacaga tcattttaat       180
     cgttataaag aagacgtaca gtggatgaag aaaacaggac aaaattcgtt ccggatttcg       240
     atttcatggg cgcgaatgtt tcctaatgat ggcgttggcg aagtgaaccc gaaagctatt       300
     gcgttttatc gcgatttact tactgaaatg aatgaaaacg gtatcaaacc attcgccaac       360
     ttatatcatt tcgatatgcc cgtggcactt caagatgctg gtggctggga atcaagagaa       420
     gttgtagatg cctatgttca ttttgcagat acttgtttta aagaatttgg cgatttagtt       480
     tatcactggt ttacgtttaa cgaaccacta ggaccgattc ttggcggcta tttagaagat       540
     ttccattatc cgaatcaaat cgacttcaaa cgcggtgcac aagctggttt taatacgatt       600
     ttggcgcatg cgttagctat taaagcattt aaaaaattaa acttgtcatc aaaaatcggc       660
     gttattttaa accttagccc gacgtatcca cgtagccaaa acgaatacga tttagaagct       720
     gcggaaattt gtgatgcttt ttacacgaga agcttcttgg atccgatggt taaaggaact       780
     ttcccagaaa aattagttga aattatgcgc gaatacgatc aaatgccgga atacacggaa       840
     gaagatttga cgattattaa agaaaatacg gcgcaaattc ttggcctaaa ttactatgaa       900
     ccaagacgcg tcaaagcccg tttaacagca attaatgaaa aaagtccgtt tttaccagat       960
     tggttttttg aaccgcataa tatgccaggt aaacgaatga atatttaccg cggttgggaa      1020
     atttatgaac gtgggattta cgatttatgt attgatattc gtgataatta cggcaatatc      1080
     gaatcattta tttctgaaaa tggtatgggt gtggcaaatg aagagcgttt cttaaatgaa      1140
     gaaggacaaa ttcaagatga ttaccggatt caatttgtca aagatcattt ggcttatgta      1200
     catcaagcga ttgcagaagg ttgcgatatt aaagggtatc atctgtggac attcattgat      1260
     tgttggtcgt ggattaacgc atataaaaac cgttacggac tcgtttcact tgatgtcgaa      1320
     actggcaaac gcacaatgaa gaaaagtggc gaattttata aaaaaatgag tgacatgaac      1380
     ggttttgaat atgatacaag caaactagtt gggacgaaaa gggaggaaac aactaatggc      1440
     tga                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page