(data stored in ACNUC10821 zone)

EMBL: AE017262.PE39

AE017262.PE39        Location/Qualifiers
FT   CDS_pept        40837..41802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0041"
FT                   /product="ROK family protein"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02829"
FT                   /protein_id="AAT02829.1"
FT                   /translation="MDIQESVIGIDLGGTKILIGEVTKDGEVLNSKSYPSNTENQTKAT
FT                   EILLKVLDDYTQNIGFIAPKQTGIGVGLVGRVNHKSGVWLEIEPGKSNPTPLADILEAK
FT                   TGLPVSLGNDVVCATMAEKQFGWGQETNDFIYLNVGTGLAAGFVVDGRITQGGHFNAGE
FT                   IGHAVVDIHSDVLCGCGRRGCVERLASGLGIKEEALRRLNNYPTSILAEAETELTGKMV
FT                   LHAAEQKDELAEEIIDNATFQLANLIMNLVRTTDPECVILGGGVTQNEHFFQKILGNLQ
FT                   SNTIRFVTKGVVRSKLEKDKVGLIGAAVIGMRLGNEGGKE"
     ttggacatac aagaatctgt catcggaatt gatctaggtg gcactaaaat tttaattggc        60
     gaagtaacaa aagatggtga ggtgctaaat tccaagagtt acccaagtaa tacggagaat       120
     cagaccaaag ctaccgaaat attgttaaag gttttagatg attacacgca aaatattggt       180
     tttatagcac caaaacaaac gggtattggt gtaggattag ttggtcgtgt gaatcacaag       240
     tcaggtgttt ggttagagat tgaacctgga aaaagcaatc caaccccgct cgcagacatt       300
     ttagaagcaa aaacaggatt acctgtaagt ctgggcaatg atgttgtttg tgccacaatg       360
     gccgaaaagc aatttggttg gggacaagaa acaaacgatt ttatttattt aaatgttggt       420
     actggtcttg ctgctgggtt tgtggtggat ggacgaatta cacaaggcgg gcactttaac       480
     gcgggtgaaa tcggtcatgc tgtagtagat attcatagtg atgtactctg tggttgcggt       540
     agacgtggtt gtgtggaacg acttgcttcc ggtcttggga ttaaagaaga ggcactgaga       600
     cgtttaaata actacccgac atccatactt gctgaagccg aaacagaact aactggaaaa       660
     atggttcttc atgcagcaga gcaaaaagat gaacttgcag aggaaatcat tgataatgca       720
     acgtttcagc tagctaattt gattatgaat ttagtccgta caaccgaccc tgaatgcgta       780
     attcttggcg gaggcgtgac acaaaatgag cattttttcc aaaagatact aggtaatctt       840
     caaagcaata caattcgttt tgttacaaaa ggtgttgttc gctctaagct tgagaaggat       900
     aaggttggct taattggtgc agccgttatt ggaatgagac taggaaatga aggaggaaaa       960
     gaatga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page