(data stored in ACNUC10821 zone)

EMBL: AE017262.PE393

AE017262.PE393       Location/Qualifiers
FT   CDS_pept        419492..421411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0398"
FT                   /product="thiamine-pyrophosphate-requiring enzyme"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03183"
FT                   /db_xref="GOA:Q723S8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR023757"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723S8"
FT                   /protein_id="AAT03183.1"
FT                   /translation="MVTEKTIRLTTAQALVKFLNQQYIEVDGEMAPFVDGIFTLFGHGN
FT                   VVGIGQALEEAPGHLKVYQGKNEQGMAHAAIAYAKQKNRQRIYACSTSAGPGSANLITA
FT                   AGTALANNLPVLFLPADTFATRQPDPVLQQLEHESSTAITTNDGFQAVSRYFDRVQRPE
FT                   QLMSALIRAFEVMTNPASAGPATICIAQDTEGEAFDYPVEFFQKRIHYLNRQIPTKREL
FT                   TEAARLIKASKTPVIIVGGGARYSRAREELIALSEQTNIPLVETHAGKSTLEFDFKNNL
FT                   GGTGILGTLAANKAIRDADLVIGIGTRYTDFTTSSKTAFDPTTKFININVSRMQTYKLD
FT                   AFQVVGDAKATLAELAPLLKGYQTQFGNKIAAYKTEWLDERARLQTTKFNRETFTPEIK
FT                   DQFDQAILNEYADRLQTEFTQTEALITINDNVAPDSIVVCSAGSLPGDLQRLWNPAVPD
FT                   TYHLEYGYSCMGYEINGALGAKMAAAKKQEVYAIVGDGSFCMSHSELLTSLQYGKKINI
FT                   MLFDNSGFGCINNLQMANGSDSFFCEFRDSDNQIMQVDYAKIAEGYGAKVYRANTKEDL
FT                   ISALEDAKTQSKTTLIEMKVLPKTMSEGYLNWWNVGVSEVSNKESIKQAYEEKQANLKN
FT                   ARLY"
     atggtgactg aaaaaacgat tcgactaaca accgcacaag ctttggtaaa atttttaaat        60
     cagcaatata tcgaagtgga cggcgaaatg gcaccgtttg tggatggtat tttcacgctg       120
     tttggacatg gaaatgtggt tggtatcggg caagccttgg aagaagcccc aggtcattta       180
     aaagtgtatc aaggaaaaaa tgagcagggc atggcgcacg cggcaatcgc ttatgcaaaa       240
     caaaaaaatc gccagcgcat ctacgcgtgt tccacatcag caggaccagg ttccgcgaac       300
     ttaataacag cagccggcac cgcacttgcg aataatttac ccgtgttatt cctgccggcc       360
     gacacattcg caaccagaca gcccgaccca gttttgcaac aattagagca tgagtcgagc       420
     acggcaatta caaccaatga tggcttccaa gcagtctcca gatattttga ccgtgtgcag       480
     cgaccagaac aactcatgag cgccctgatt cgcgctttcg aagtaatgac caacccagcg       540
     agcgcgggac cagcaacaat ctgcattgcg caagacacag aaggagaagc attcgattat       600
     ccagtcgaat tttttcaaaa acgaattcac tatcttaatc ggcaaatccc gacaaagcgt       660
     gaactaaccg aagcagctcg gctcatcaaa gcgagcaaaa ccccagttat catcgtcgga       720
     ggtggcgccc gctattcaag agcacgcgaa gaattgatcg ccctttccga gcaaaccaac       780
     attccgctcg tcgaaacaca tgccgggaaa tcaacgcttg agtttgactt caaaaacaac       840
     ctaggtggca cgggaatcct cgggacgctt gctgccaata aagctatccg tgacgccgat       900
     ttagtcatcg gaattggcac gcgctatacc gatttcacaa ccagttccaa aacggcattc       960
     gatccaacaa ccaaatttat caatatcaat gtcagccgta tgcaaacata caaattagat      1020
     gccttccaag ttgtcggtga cgccaaagca accctagccg aactagcgcc acttttaaaa      1080
     ggttatcaga cccaatttgg aaacaagata gccgcataca aaaccgagtg gctagacgaa      1140
     agagcacggc tacaaaccac caaattcaac cgagaaacat ttacgccaga aatcaaagat      1200
     caattcgacc aagcgatctt aaacgaatat gcagaccgct tgcagaccga atttacgcaa      1260
     acagaagcac ttatcacaat taatgacaac gtggcaccgg atagcattgt cgtttgttcg      1320
     gccggttcac ttcccggaga tttgcaacga ctctggaacc cagccgtacc agacacctat      1380
     cacttagaat atggctattc ctgcatgggc tacgaaataa acggtgctct cggcgcgaaa      1440
     atggccgcag caaaaaaaca agaagtatac gccatcgttg gcgacggcag cttctgcatg      1500
     tcacactcag aactactaac atccttacaa tacggcaaaa aaattaacat tatgctcttc      1560
     gataattccg gttttggctg cattaacaac ctccaaatgg caaacggcag cgacagtttt      1620
     ttctgcgaat tccgcgatag cgacaaccaa atcatgcaag tcgattacgc caaaattgca      1680
     gaaggatacg gagcaaaagt ctatagagcc aacacgaaag aagatttaat cagcgcactg      1740
     gaagacgcaa aaacacaaag caaaactact ttgatcgaaa tgaaagtact accaaaaact      1800
     atgtcagaag gctatcttaa ttggtggaat gtgggagttt ccgaagtttc aaacaaagaa      1860
     agtatcaagc aagcatacga agaaaaacaa gcaaacctga aaaatgcccg actatattaa      1920
//

If you have problems or comments...

PBIL Back to PBIL home page