(data stored in ACNUC10821 zone)

EMBL: AE017262.PE395

AE017262.PE395       Location/Qualifiers
FT   CDS_pept        422009..422377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0404"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03185"
FT                   /protein_id="AAT03185.1"
FT                   /translation="MRIFCGIMSIQAGFIGALAEILSPDSKKNNLFMIPEDLAASSGYL
FT                   MSLAMVLAGILIICAYRNDFLIFMALILWLFGLIFGLIFTPSYSGFYFRPIVCLISFLM
FT                   GLFIFTDYTRHQDTGEER"
     atgcgtattt tttgtgggat tatgtcaatc caagcaggct ttattggtgc tcttgctgaa        60
     atactaagtc cggacagtaa aaaaaataac ttattcatga taccggaaga tcttgcggca       120
     tcatcaggct atttaatgtc tcttgcgatg gttttagcgg gaattctaat aatttgtgct       180
     tatcgaaatg attttctaat attcatggca ctaattttat ggctctttgg acttattttt       240
     gggctcattt tcaccccgag ttattcgggt ttttatttcc gcccaatcgt atgtttaata       300
     agctttttaa tgggcctatt tatttttaca gattacacaa ggcaccaaga cacaggcgag       360
     gaaaggtga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page