(data stored in ACNUC10821 zone)

EMBL: AE017262.PE398

AE017262.PE398       Location/Qualifiers
FT   CDS_pept        424480..424779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0403"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0407"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03188"
FT                   /protein_id="AAT03188.1"
FT                   /translation="MKHNFTEDDFVYGESWGLVHRGVLEDKEVERMKALRDKVVGKKGV
FT                   AQTTLKPIGSVRIDGEVYEARLKTGYLEVGKPIIAVGIDFGYVLVNEDIQEGEK"
     ttgaagcata attttacaga agatgacttt gtttatggag aatcatgggg actcgtgcat        60
     cggggggttt tagaggacaa agaagtagaa agaatgaaag cgctacgaga caaagtagtg       120
     ggtaaaaaag gcgtagcaca aacgacactt aagccgatag gtagtgtcag aatagacgga       180
     gaagtctatg aagctcgctt gaaaacaggt tatttggaag ttggaaaacc aataattgca       240
     gtaggtatcg atttcggata cgtactagtc aatgaagata tacaggaggg agaaaaatga       300
//

If you have problems or comments...

PBIL Back to PBIL home page