(data stored in ACNUC10821 zone)

EMBL: AE017262.PE401

AE017262.PE401       Location/Qualifiers
FT   CDS_pept        426315..427031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0406"
FT                   /product="NLP/P60 family protein"
FT                   /note="identified by match to protein family HMM PF00877"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03191"
FT                   /protein_id="AAT03191.1"
FT                   /translation="MLCVYKKGVRGLKIIATRRKIFFAFIALMISFSVLFLPTTNASAA
FT                   TTYKMTTTADVNVRAADNTKGKVIGFYKKGTTVTFTAKTKNNWYKTTYKGKVGYVSGKC
FT                   VTTYKAPVATTQSFTALNNEARKHIGKRYKIGATGPSCFDCSGYTQYVYSKGVKKSIPR
FT                   TAKQQYASAKKIKAQELKKGDLIFFNYGKGVAHVGIYVGNGKMLNAQNNGVKYDTITSG
FT                   YWKKYIAGYGRVANLK"
     atgctgtgtg tatataaaaa aggggtgcgt ggattgaaaa taatagcaac gagaagaaag        60
     attttttttg cgtttatagc tttaatgatt tctttttcag tactattttt accaacaact       120
     aacgcttcag cagcgactac atataaaatg acgacaacgg ctgatgtaaa tgttcgcgca       180
     gcagacaaca ccaaaggtaa agtcatcggt ttttacaaaa agggtacaac ggttactttc       240
     actgctaaaa caaaaaacaa ctggtataaa acgacataca aaggcaaagt tggttatgtt       300
     tcaggtaaat gtgtgactac atataaagca cctgttgcaa caacgcaaag ttttaccgca       360
     ttaaataacg aagcaagaaa acacattggc aaacgctaca aaattggcgc tactggccca       420
     agctgttttg attgttcagg ttacacacaa tatgtatact ctaaaggagt taaaaaatcc       480
     attcctcgta cagcgaagca acaatatgcc tctgctaaga aaattaaagc tcaagaacta       540
     aaaaaaggtg atttgatttt cttcaattat ggtaagggtg ttgcacatgt tgggatttat       600
     gttggaaatg gcaaaatgct taatgcgcaa aataatggcg taaaatacga cacaatcaca       660
     tctggctatt ggaaaaaata tattgctgga tatggacgag tagcaaattt aaaataa          717
//

If you have problems or comments...

PBIL Back to PBIL home page