(data stored in ACNUC10821 zone)

EMBL: AE017262.PE402

AE017262.PE402       Location/Qualifiers
FT   CDS_pept        427087..427512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0407"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03192"
FT                   /protein_id="AAT03192.1"
FT                   /translation="MQYKIKEMPLEELEPKVVEGLLEHKERLGYDIPKKDTEYIGFAAL
FT                   SEVGEIVGGVTAKISYGELYVSLLSVDPSTQGSGVGTELMAQIERYGRANNCHHISLTT
FT                   FSYQAPGFYKKCGFTELGRVKDFPIIGEEKYFFIKYL"
     atgcaatata aaataaaaga aatgccactg gaagaactag aacctaaagt agtagagggg        60
     cttttggaac ataaagaaag attaggttat gacattccaa aaaaagacac agagtatatt       120
     ggctttgcgg ctttaagtga agtaggggaa atagttggag gagttacagc gaaaatcagc       180
     tacggagaat tatatgtgtc tcttctttct gttgatccaa gcacacaagg atcgggcgtg       240
     ggtacagaat tgatggccca aatagaaaga tatggtagag caaataactg ccaccatatc       300
     tccttaacaa catttagtta ccaagcccca ggattttata aaaaatgcgg ttttactgag       360
     cttggacgtg taaaagattt tcctataata ggagaagaaa agtacttttt tattaaatat       420
     ttatag                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page