(data stored in ACNUC10821 zone)

EMBL: AE017262.PE406

AE017262.PE406       Location/Qualifiers
FT   CDS_pept        429060..429161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0411"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03196"
FT                   /protein_id="AAT03196.1"
FT                   /translation="MNFFLQLLGNFSGAINFPDVTEVLNNLIKGIFG"
     gtgaattttt tcttacaatt attaggtaat ttttctggag cgattaactt tccagacgta        60
     acagaagtac taaacaatct aatcaaaggg atttttggtt ga                          102
//

If you have problems or comments...

PBIL Back to PBIL home page