(data stored in ACNUC10821 zone)

EMBL: AE017262.PE407

AE017262.PE407       Location/Qualifiers
FT   CDS_pept        429199..429300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0412"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03197"
FT                   /protein_id="AAT03197.1"
FT                   /translation="MNFFLQLLGNFSGAIRFPDVAEVLNNLIKGIFG"
     atgaattttt tcttgcaatt gttaggtaat ttttcaggtg caatccgctt tccggacgta        60
     gcagaagtac taaacaactt aatcaaaggt atctttggtt aa                          102
//

If you have problems or comments...

PBIL Back to PBIL home page