(data stored in ACNUC10821 zone)

EMBL: AE017262.PE408

AE017262.PE408       Location/Qualifiers
FT   CDS_pept        429391..430614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0413"
FT                   /product="cell wall surface anchor family protein"
FT                   /note="identified by match to protein family HMM PF07523;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03198"
FT                   /protein_id="AAT03198.1"
FT                   /translation="MKKIIALITAVALLSMIGFAFIPGTVANAANSSESSLTYKDVRSG
FT                   FYFVGYENVQLETGKTYKYTVAYEANVDMKMTDTITGQSAKAGLFTPKSSGAELNTSYV
FT                   SRTKNNVIDVADAGNKVFKHTFEFTAKENTKADIGVFLGAGSVLPTTPETTSLWKNVTV
FT                   TNETPLVQAEAPVISAEDKTINQNESFNPLNEVTASDEKDGDITKDIHVTKNTVDTTKS
FT                   GKYDVDYSVTNSSNLTTTKSIKVTVTPAAISKNTAPVINAKDQTIKVGDVFNVLKGVTA
FT                   KDNEDGDLTAKIKVTKDTVNNSKKGVYQVTYTVTDSGNLSASLTIKVTVTQDGKLIVNP
FT                   SDPTKPSITKTPVEPTKIEKDPENRATSVLKASKIPKTGDSSMIWLVFVGLGLTAIGIS
FT                   SYQKKANK"
     atgaaaaaaa taatcgcgtt aatcacagca gttgcacttc tatcaatgat tggatttgcc        60
     tttatccctg gtactgttgc gaatgcagcg aattcatcag aaagcagttt aacatacaaa       120
     gatgtacgca gtggatttta ctttgttggt tatgaaaatg tacaacttga aacaggaaaa       180
     acatacaagt acacagtagc gtatgaagca aatgttgata tgaaaatgac agatactatt       240
     acaggacaat cagcaaaagc aggacttttt acaccaaaat catccggtgc cgagctgaac       300
     actagttacg taagccgaac aaagaataac gttatagacg tagctgatgc aggtaataag       360
     gtttttaaac acacatttga atttacagcg aaggaaaata caaaagcaga tatcggtgtt       420
     ttcttaggag caggttctgt tcttccaaca actccagaaa ccacgtccct ttggaaaaac       480
     gtaaccgtga caaatgaaac tccactagta caagcggagg ctccagttat tagtgcagaa       540
     gataaaacta tcaatcaaaa tgaaagtttt aatccactaa atgaagtcac tgcgtcagac       600
     gaaaaagacg gtgatattac aaaggacatc cacgtaacca aaaatacggt agatacgact       660
     aagagtggca aatatgatgt ggattatagc gttacaaatt caagcaactt aacaacgaca       720
     aaaagtatta aagtaaccgt aaccccagca gcaataagca aaaatacagc cccagttatt       780
     aatgcaaaag atcaaacaat caaagttgga gatgtgttta atgtgttaaa aggagttact       840
     gcgaaagata acgaagatgg tgatttaaca gcaaaaatca aagtgaccaa ggatacagtg       900
     aataattcga aaaaaggtgt ttatcaagtt acatatactg tgacagattc tggcaatcta       960
     tcagcttcac ttacaattaa agtgactgta actcaagatg gaaaactaat agtaaatcca      1020
     agtgatccaa caaagccatc tatcacaaaa acacctgtgg aaccaacaaa aattgaaaaa      1080
     gatcctgaaa atagagcgac ttccgttttg aaagcaagta aaataccaaa aactggtgat      1140
     agttcaatga tatggctagt atttgtcgga ctcggcttaa cagctattgg tattagttct      1200
     tatcaaaaaa aagcaaataa ataa                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page