(data stored in ACNUC10821 zone)

EMBL: AE017262.PE409

AE017262.PE409       Location/Qualifiers
FT   CDS_pept        430731..431381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0414"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03199"
FT                   /protein_id="AAT03199.1"
FT                   /translation="MPKIAKGNRLENVAFEYIKNKITTGEYPTGYRVVEAKLSQELNMS
FT                   RTPIRRAIINLCHSGFLVHQYNRGAFVQNTEVTITEFFSRMKLVELLMYESTEKLILRE
FT                   DYIVVDDIIEIAEKVIQYEKNKEYELMRDTFEDFIVAFIGKLNNDYFNRIIQELWNEIN
FT                   DNATKEVRLIIVSASDRIAEELANIIEILKSWNYGELKKCFQHIMNAMILIAF"
     atgccaaaaa ttgctaaagg taatcgactc gagaatgttg cttttgagta cattaagaac        60
     aaaatcacaa ctggggagta tccaacgggt tatcgtgttg tagaagcaaa gttatctcaa       120
     gaactaaata tgagtaggac accaattagg cgagcgatta tcaacctttg ccattctgga       180
     tttttagtcc accaatataa tcggggtgct tttgttcaaa acactgaagt aactattaca       240
     gaattttttt cgcgaatgaa attagtcgaa ctattgatgt atgaaagtac agaaaaatta       300
     attctacgtg aagattatat tgtagtggac gatataatag aaatagccga gaaagtaatt       360
     caatatgaaa aaaacaaaga atatgaatta atgcgcgata cgtttgaaga ttttatcgtc       420
     gcatttatag gtaagctaaa taatgattat tttaatagaa taattcaaga attatggaat       480
     gaaatcaatg ataatgcaac aaaagaagta agactaatta ttgtttcggc aagtgatcga       540
     attgcggaag aattagctaa tataattgaa attttaaaat catggaatta cggggaacta       600
     aaaaaatgtt ttcaacacat aatgaacgca atgattttga ttgcttttta a                651
//

If you have problems or comments...

PBIL Back to PBIL home page