(data stored in ACNUC10821 zone)

EMBL: AE017262.PE410

AE017262.PE410       Location/Qualifiers
FT   CDS_pept        431426..432025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0415"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03200"
FT                   /protein_id="AAT03200.1"
FT                   /translation="MLVIVAASVGYYFIKENERKTPQTIDYKTVETKRTDLSVYVSAEG
FT                   HIVKKVNEWPDYEDFAVKIMVDELEINQIKEKQTADVYVQAVNNKVYKGKVVDINEKGI
FT                   INGSVTSYAVTIDLEDETKVKENMSVSADVLVALEKKILTIPIEAVNTDKADKHYVYTV
FT                   DANKQKKKIWIEVGKHNTKSIQVVKGLTEKQLVIIP"
     atgctggtta tcgttgctgc atcggttggc tattatttta taaaagaaaa tgagcgaaag        60
     acgccacaaa caattgatta caaaacagtt gaaacaaaaa gaacagattt aagtgtatat       120
     gtttccgcag aaggtcacat tgtaaaaaaa gtaaatgaat ggccagatta tgaagatttt       180
     gctgtcaaaa ttatggtaga tgagctagaa attaaccaaa taaaagaaaa acagacagct       240
     gatgtgtatg tccaagcagt aaataataaa gtatacaaag gaaaagttgt agatataaat       300
     gagaagggca ttataaacgg gtcagtaact tcttatgccg tgacgattga tttagaggat       360
     gagacgaaag taaaagaaaa tatgtctgta agtgctgatg tacttgtggc tctagaaaaa       420
     aagattttaa caattccaat agaagctgtt aatacggata aagctgataa acattatgtc       480
     tatacagttg atgcaaataa acaaaagaag aaaatttgga ttgaagtagg caaacataat       540
     acgaaatcta ttcaagtagt aaaaggtctt acagagaaac aacttgtgat tattccatag       600
//

If you have problems or comments...

PBIL Back to PBIL home page