(data stored in ACNUC10821 zone)

EMBL: AE017262.PE412

AE017262.PE412       Location/Qualifiers
FT   CDS_pept        432702..433880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0417"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03202"
FT                   /protein_id="AAT03202.1"
FT                   /translation="MEQIMTLLQSIKLALKQLLSTKFRTFLTMLGIIIGVFSVTLLVSI
FT                   GEAISKNVSTQLGDMGSNLLTVNFYSDNPNDKFTYKDAKKLLNEDEIGSPEVIQTKEVR
FT                   TSEKTASNQVAGINEYYASIKNLELASGRFCSNVDVIYAQKVTIIGSEIAKTYFKEQNP
FT                   IGEYLQIAGARYMVIGVLKEKGESLFGSADKKLFIPISSAERLFKTDTVDLYYIQTKKV
FT                   EQVPAAVKVVKKKMSQFFPNNEDAYTVANQQQALDTFDSITGTLTIGLGAIAGISLLVG
FT                   GIGIMNIMLVSVSERTREIGIRKAIGASSGNILMQFLIEAVVLSLVGGCIGILLGIFSA
FT                   QIVTTTSSFEMYVSASTILLAVGFSMCIGIVFGVIPAQKASKKMPIDALRAD"
     atggaacaaa ttatgactct tttacagagt ataaagttag cgctaaaaca attattgtcc        60
     accaaatttc gaacattttt aacaatgctt ggaattatta ttggtgtttt ttctgttaca       120
     ttacttgttt cgattgggga agctatatcg aaaaatgtct ccacacaatt aggtgatatg       180
     ggaagtaatc ttttgactgt taatttttat tcagataatc caaatgataa attcacatac       240
     aaagatgcaa aaaaactttt gaatgaagat gaaattggtt cgccggaagt gatacagaca       300
     aaggaagtta gaacaagtga aaagacagct agtaatcaag tagcgggaat aaatgaatat       360
     tatgcgagca taaaaaattt ggaattagca tcaggccgtt tttgctcgaa tgtagatgtt       420
     atctatgccc aaaaagtgac aattattggc tcagaaattg caaaaactta ttttaaagaa       480
     cagaatccga taggtgaata tttgcaaatt gcaggtgcta ggtacatggt cattggagtt       540
     ttaaaggaaa agggggagag tttatttgga tcggcagaca aaaaactttt tatcccaatt       600
     tcttccgcag aacgactttt taaaacagat actgtggatt tgtattatat tcaaacaaaa       660
     aaagtagaac aagttccagc agcagttaag gtagtaaaga aaaaaatgag ccagtttttt       720
     ccgaataatg aagatgcgta tacagttgca aatcagcaac aggcgttaga tacgtttgat       780
     agtattacgg gaacactcac gattggacta ggtgcgattg cagggatttc gctactcgtt       840
     ggcggtattg gtattatgaa tattatgctc gtgtctgtct cagaacgaac ccgagaaatt       900
     ggaattagaa aagcgattgg cgcaagtagt ggcaatattt taatgcagtt tttgattgaa       960
     gcagttgtgc ttagtttagt aggcggttgt atcgggattt tactaggaat tttttccgcg      1020
     caaatagtta caactacatc aagttttgaa atgtatgttt ctgcttctac gattctttta      1080
     gcggttggtt tttcgatgtg tattgggatt gtatttggtg taattcccgc acagaaagct      1140
     tcaaaaaaaa tgccgataga tgcgttacgg gcagattaa                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page