(data stored in ACNUC10821 zone)

EMBL: AE017262.PE414

AE017262.PE414       Location/Qualifiers
FT   CDS_pept        434113..434595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03204"
FT                   /protein_id="AAT03204.1"
FT                   /translation="MNESICKRDNGGAVVNFELEINATKAEVFALLTTNAGLAKWFNEL
FT                   EVGELGADGYLLFVMTPEEKITMPIRAFETNQKLAFEWDQDEVDFELNEITANKTRLTF
FT                   REQLTTITEHSPRDISGWHICLKKLQASAEGKIYDFNKTEFETLFAKYQKELNIEK"
     atgaacgaat ctatttgtaa acgggataac ggaggagctg tagttaattt tgaattggaa        60
     attaatgcaa caaaggcaga ggtttttgct ttattaacga caaacgccgg actagcaaag       120
     tggtttaatg agctggaagt aggcgaacta ggagcagatg gctatctact tttcgtcatg       180
     acacctgaag aaaaaataac catgccaatt cgtgcattcg aaactaacca aaaacttgct       240
     ttcgaatggg accaagatga agttgacttt gaactaaatg aaatcaccgc aaataaaaca       300
     agattgactt tcagagaaca acttacgact attacggaac acagccctag agatatttcc       360
     ggttggcata tttgcttgaa gaaattacaa gcgagcgcag aaggaaaaat atacgatttc       420
     aacaaaacgg agttcgaaac gctcttcgcc aagtatcaaa aagaacttaa tatcgaaaaa       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page