(data stored in ACNUC10821 zone)

EMBL: AE017262.PE415

AE017262.PE415       Location/Qualifiers
FT   CDS_pept        436683..439316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0421"
FT                   /product="glycosyl hydrolase, family 38"
FT                   /note="identified by match to protein family HMM PF01074;
FT                   match to protein family HMM PF07748"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03205"
FT                   /protein_id="AAT03205.1"
FT                   /translation="MKMAKTKVHVIPHSHWDREWYFTSSRSTIYLVKHLKEVIETLEAK
FT                   DDYHFYLMDAQSSLIEDYLHYCPEDKTRLEKLIAEKRLITGPWYTQTDQLVISQESIVR
FT                   NLLYGTRIAREMGHSMAVGYVPDAFGQGGNMPQIYKEFGISKFLFWRGVADNRLKQTEF
FT                   IWRGDDGTEMLAEQIPFGYYYGANIPENEAELKTYLDDQIGALEEKASTRNVYFPNGLD
FT                   QAPVRENLPELVAKFNELDSTREYQIASPETFFADLEKDVTNLPVIAGELTEGKHSRLH
FT                   KSIFSTRADLKQANNEIENFLSNVLEPVLSISYSLGNRYPHNELAEIWKLMFENAAHDS
FT                   IGGCNSDTTNRDVKHRYKLASDLATNLLDLNMRLISEKIEQKQPFQFTVFNPLPYEKSG
FT                   VIKMTAYIPEDNFEIEDTQGNTLEYTILEKTDLTDYVLNQHIDLNPSKSIYLPEKVFLA
FT                   TMLVNVNSLPALGYDTIYFNLEKETAEQEPTQSTMTKIENEFYEIQLAANNSLTIHDKK
FT                   AGRTYTDQMLFVENGDDGDSYNYSPPRKDLVISSEEAVVESLESSISSVNQTLTISFKL
FT                   NVPYNLEERANGEKSNEMTIKTVISLRKNEELIRFDVQVANQVLSHRLCVTFATEIASK
FT                   FSTADQLFAPIQRPVRLPEMDVWEAEEWQEAPISIEAMQSFVSLHDEAHGVAVMTEGVR
FT                   EYEIIGENYDTISLTLFRTFSHMGKTDLLYRPGRASGESIVATPDAQLLGEINATFALT
FT                   LFESSFDEADIAKKAKEYLSNPPVYQMSDFLNGRLIYVYRDEEKTLDATYSLALPTIDG
FT                   AIISAVKKAEDADAFITRFFNPYLQKEITIPEVFRGKERHLDESESNEKQTRLKHAKVQ
FT                   SYLFEK"
     atgaaaatgg ctaaaacgaa agtacacgta attccgcatt cgcactggga tagagaatgg        60
     tatttcactt caagccgttc aacaatctat ttagtgaagc atttaaaaga agtaattgaa       120
     acattggaag cgaaagacga ttaccatttt tacttaatgg atgcgcaaag ctcgttaata       180
     gaagattatt tgcactactg cccggaagat aaaacaagat tagaaaaact gattgctgaa       240
     aaacggctta ttaccgggcc atggtacaca caaacggacc aattagtcat ttcacaagag       300
     tcgattgtta gaaacttgtt atatggtacg agaattgcac gcgaaatggg acatagcatg       360
     gctgtcggtt atgtcccgga tgcgttcgga caaggcggga acatgccaca aatttataaa       420
     gaatttggaa tttcaaagtt tctgttttgg cgcggagttg ccgataatcg cttaaaacaa       480
     accgaattta tctggcgcgg tgatgatggg acggaaatgc tagcagagca aattccgttt       540
     ggctattact acggcgcgaa cattccggaa aacgaagccg aacttaaaac ctatttggat       600
     gatcaaattg gtgctctgga agagaaggcc tcaacgcgaa atgtctattt cccaaatggc       660
     ttagaccaag cgccagttag ggaaaatttg ccagaattag ttgcgaaatt caatgaatta       720
     gatagcacgc gggaatacca aatcgcatca ccagaaacat ttttcgcgga cttagaaaaa       780
     gatgtgacca atttgccagt cattgctggt gaactaacag aaggaaaaca tagtcggctg       840
     cacaaatcga ttttctctac tcgagctgat ttaaaacaag caaacaatga aatcgaaaac       900
     tttttaagta atgtattaga gccggttctt tccatcagct actctcttgg aaatcgctat       960
     ccgcacaatg aactcgcaga aatttggaag ttaatgtttg aaaatgctgc acatgatagc      1020
     attggcggct gtaatagtga tacaaccaac cgcgacgtca aacatcgtta caaattggct      1080
     tcggatttag cgaccaattt actcgattta aacatgcgcc taatcagcga aaaaatcgaa      1140
     caaaaacaac cgttccaatt taccgttttc aacccactac catacgaaaa aagcggtgtg      1200
     attaaaatga ccgcgtatat cccagaagat aatttcgaga tagaagatac gcaaggaaac      1260
     acgcttgaat acacgatttt agaaaaaaca gacctaactg attacgtctt aaatcaacat      1320
     atcgacctaa atcctagcaa atccatttat ttgccagaaa aagtcttttt agcaacaatg      1380
     ctagtaaacg taaatagtct tccggcgcta ggctacgaca ccatctactt taatttagaa      1440
     aaagaaacag cggagcaaga accaacacaa tccaccatga caaaaatcga aaacgaattt      1500
     tatgaaatcc agctagctgc caacaattca ctcacgattc atgataaaaa agcgggcaga      1560
     acctatacag atcaaatgct ttttgtggaa aatggcgatg atggcgattc gtataactat      1620
     tcgccaccac gtaaagacct tgtaatctca tcggaagaag cggtagtgga aagcctagag      1680
     tctagtatat caagcgtcaa ccaaacatta actatttcct tcaagttaaa tgtaccgtat      1740
     aatttagaag aacgtgcaaa tggtgaaaaa agtaacgaaa tgactatcaa aacagtaatt      1800
     tctttacgta aaaatgaaga actcattcgc tttgatgtac aagttgctaa tcaagtattg      1860
     agtcatcgtt tatgtgttac attcgccacc gaaattgcta gcaaattctc aacagctgat      1920
     caattattcg caccaatcca gcgtccggtt cgtcttccag aaatggatgt atgggaagca      1980
     gaagaatggc aagaagcgcc aatttcgatt gaagctatgc aaagttttgt cagcttacac      2040
     gatgaagctc atggggttgc tgtaatgaca gagggcgtac gcgaatatga aatcattggc      2100
     gaaaattacg atacgatctc gctaaccctg ttccgcacat ttagccatat gggtaaaact      2160
     gatttactat atcgtcctgg tcgcgcttcc ggtgagtcaa tcgttgcgac accagacgca      2220
     caactgcttg gcgaaataaa tgccacattt gcgctaactt tattcgaaag ctcttttgac      2280
     gaagcggata tcgcgaaaaa agcaaaagaa tatctgtcga acccgccagt ttaccaaatg      2340
     tctgattttc taaacggccg cttgatttat gtttaccgcg atgaagaaaa aacgctagat      2400
     gccacatata gcctggcact tccgacaata gatggagcga ttattagtgc agtaaaaaaa      2460
     gccgaagacg ccgatgcctt cattacacgc tttttcaatc catatttaca aaaagaaatt      2520
     accatcccag aagttttccg aggcaaggaa cgccacttgg atgaaagcga atcaaacgag      2580
     aaacaaacga gattaaaaca tgcaaaagta caaagctatt tatttgaaaa ataa            2634
//

If you have problems or comments...

PBIL Back to PBIL home page