(data stored in ACNUC10821 zone)

EMBL: AE017262.PE416

AE017262.PE416       Location/Qualifiers
FT   CDS_pept        439349..441283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0422"
FT                   /product="PRD/PTS system IIA 2 domain protein"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM PF00874; match to protein
FT                   family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03206"
FT                   /protein_id="AAT03206.1"
FT                   /translation="MGYFAYKRLETLYGMLLDAGSHLSAQKLSQDLHISERTIRTDIAK
FT                   LTEFLESHGATITLTRGAGYKIEILDSLVFQAFQAEKNKPKNAGYFDLDNPEERVKYEI
FT                   FMLLSSGDYIKLEDLADTIFASRATISNDMKQVRKVIAVYDLTLVSKPGSGVKIIGEEE
FT                   KMRYALTALIASKNAPESYLETFFEWHKQKDKLQKLMTAVTDYFFATNIRFTDEALQNL
FT                   LLHMMILVERIELGHTLEKFELTDVSEEEIAIATKLSTIIESLFEIDIADADKNYLLLQ
FT                   IASKRILNVEDKEISEFDDYAYIEGMLNRIESHYFYHLQDDMQLKKDLVAHIHSMLYRV
FT                   KYHMTVKNPMTEHIKRYYPLAYEITLDAVESLKKDYPYDINQNELAYLALHIGASLERN
FT                   YQISYYRHKSALIVCGSGFGTARIVEAKVKSAVSNLDITKVVSIQEYNRFIHIEEDIIL
FT                   STVRIPEKNKPVIKISNIPTNEELKMLGAIIQEQTDPNRGFLSNFFTADFFARSSMTNK
FT                   TAILEEMVDSLRQQNIVGEGFLQSVLEREKLGSTVLGTGIAIPHPLGLMAKETKIVIRI
FT                   LDKPIKWDQKQSVRAVFLLCISKNDYEEAINIYELLVELVREEYGEKLSRLSDFHAFTA
FT                   LANDILKKK"
     atgggatatt tcgcttataa acgtttggaa acactatatg gcatgctcct tgatgcgggt        60
     agccacttat cagctcagaa actcagccaa gatttacata tttccgaacg tacgatacga       120
     acagatattg ctaaactaac tgaatttctc gaaagccacg gggcaacgat aacgctaact       180
     cgaggcgcgg gatacaaaat cgaaatcctt gattcgttgg tttttcaagc ttttcaggcc       240
     gaaaaaaaca aaccaaaaaa tgcgggttat tttgaccttg ataatcccga agaacgcgtg       300
     aaatacgaga ttttcatgct gctatcaagc ggcgactata ttaaattgga agacttggca       360
     gatacgattt ttgctagccg tgcaaccatt tcaaatgata tgaagcaagt acgaaaagtt       420
     attgcggtgt atgatttaac gctcgtctca aaaccaggta gcggcgtgaa aatcatcgga       480
     gaagaagaaa aaatgcgcta tgctctaacc gcgttaattg cttccaaaaa cgccccggaa       540
     tcctacttag aaacattttt cgaatggcac aaacaaaaag ataaactgca aaaattaatg       600
     acagctgtga cggattattt ttttgcgacc aacattcgtt tcacagacga agcgcttcaa       660
     aacttacttt tacatatgat gattttggtg gaacgaattg aactcggtca tacgttggaa       720
     aagtttgaat taacggatgt tagtgaagaa gaaatcgcga ttgcgactaa attgtctact       780
     attatagagt cgcttttcga aatagacatt gcggatgcgg acaaaaatta tttgcttctc       840
     caaatcgcca gcaaacgaat tctgaatgta gaagataaag aaattagcga atttgatgat       900
     tacgcgtata ttgaaggcat gttgaaccgc attgagtccc attactttta tcatttacaa       960
     gatgatatgc agcttaaaaa ggaccttgtt gctcatattc attccatgtt atatcgagta      1020
     aaataccata tgaccgtcaa aaatccaatg acagagcaca ttaaacgcta ttacccttta      1080
     gcctacgaaa tcacgctcga tgcagtggaa tcactaaaaa aagactaccc gtatgacatt      1140
     aatcaaaatg aattagccta tttagcgctg catattgggg catccttaga gcggaattat      1200
     caaatctctt actatcgtca taaatcagcc ttgattgttt gtgggtcagg ctttggaaca      1260
     gcacgaattg tagaagcgaa agtaaagtca gcagtgagta atctcgatat tacaaaagta      1320
     gtttcaatcc aagaatataa ccgttttatc catattgaag aagatatcat tctctccacc      1380
     gttagaatac ctgagaaaaa taaaccggtc atcaaaatca gcaatatccc aaccaatgaa      1440
     gaattaaaaa tgcttggtgc cattattcaa gaacaaaccg atcctaaccg cggctttcta      1500
     tcgaattttt tcacagctga tttttttgcc agaagcagta tgacaaacaa aacagcaatt      1560
     ttagaagaaa tggttgactc attacgccaa caaaatattg ttggtgaagg cttcttgcaa      1620
     tcggttcttg aacgtgaaaa attaggctca actgtactcg gaaccggaat agcaatccca      1680
     catccactcg gactaatggc caaagaaaca aaaatcgtta ttcggatatt agataaacca      1740
     atcaaatggg atcaaaaaca atccgttcgc gccgtatttt tattatgtat tagcaaaaat      1800
     gattatgaag aagccattaa tatttatgaa ttgctagtag aattagtacg cgaagaatat      1860
     ggtgagaagc tttcaaggct ttccgacttt catgcattca ctgctttagc aaatgatatt      1920
     ttgaagaaaa aataa                                                       1935
//

If you have problems or comments...

PBIL Back to PBIL home page