(data stored in ACNUC10821 zone)

EMBL: AE017262.PE417

AE017262.PE417       Location/Qualifiers
FT   CDS_pept        441410..441826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0424"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03207"
FT                   /protein_id="AAT03207.1"
FT                   /translation="MNRQTEFTLLIVGASLSILTFLGAMLYTIIFGLNTLMVADTFGYY
FT                   SSSEETIVLGIITFFSVVAAFFALGSAVFGFIGAFKVKSDGPKVKTLGVCFIVLGGLQV
FT                   FTIHGILFLIAGILTITKKEYKTNSKEDEGTKWE"
     atgaacagac aaacagaatt tacattactt attgtggggg cttcattaag cattttaact        60
     tttctaggtg ctatgttgta taccattatt tttggactta ataccctaat ggtagctgat       120
     acttttggtt attatagtag ctcagaagaa acgattgtac ttgggataat tactttcttt       180
     tcagtagttg ctgcattttt tgcactcgga tcagcagttt ttggatttat cggtgcattt       240
     aaagttaaaa gtgacgggcc aaaagtaaaa acattaggcg tttgttttat cgttttgggt       300
     ggattgcaag tatttactat tcacggaatt ttatttttga ttgcaggaat tttaacaatt       360
     acaaaaaaag aatacaaaac aaattctaaa gaagatgagg ggacaaaatg ggaatga          417
//

If you have problems or comments...

PBIL Back to PBIL home page