(data stored in ACNUC10821 zone)

EMBL: AE017262.PE418

AE017262.PE418       Location/Qualifiers
FT   CDS_pept        441823..442215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03208"
FT                   /protein_id="AAT03208.1"
FT                   /translation="MITFLPIFFIFAIFLGLAAKVLLAIWIYKDAEQRGMNAILWCLLM
FT                   VFINVIIILVIYLIVRNKGEVMKQNLGLLISGIGIAVLNTLMAIMAFIFIIFFAVNDGG
FT                   MHNMMDGYNYDYDDGYEYDMDNFEDF"
     atgataacgt tcttaccaat attttttatt tttgcgattt ttttaggact agcagcaaaa        60
     gtccttttag caatttggat ttataaagat gctgaacaac gcggaatgaa cgcaattctt       120
     tggtgtctgt taatggtttt cattaatgtc attattattc ttgttattta cctgatcgta       180
     cgtaataaag gagaagtcat gaagcaaaat ttaggactac taattagtgg tattggtatt       240
     gcggtactaa atacattaat ggcgattatg gcttttattt ttataatctt ttttgcggtg       300
     aatgatggtg gaatgcataa tatgatggac ggttataact atgattatga cgacgggtac       360
     gagtacgata tggataattt tgaagatttt taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page