(data stored in ACNUC10821 zone)

EMBL: AE017262.PE419

AE017262.PE419       Location/Qualifiers
FT   CDS_pept        442324..443331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0425"
FT                   /product="phosphate transporter family protein"
FT                   /note="identified by match to protein family HMM PF01384"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03209"
FT                   /protein_id="AAT03209.1"
FT                   /translation="MDTVILITVIIVIMGLAFDFINGFHDIANAVATSISTRALKPRVA
FT                   IGIAAVMNFLGAISFTGVAESLTKSIVDPFSLNNGEFVVLCGLIAAVIWNLMTWLVGMP
FT                   SSSSHALIGAIAGASIASASSFSVLNWSGFTTIIIALIISPIIGFTVGYLIYSLFKHLF
FT                   HDKKLGKMNRRFRFIQIGTAAAQAYSHGTNDAQKTMGIITLALVASGLLKESAGIPFWV
FT                   QVSCAASMAIGSSVGGYRIIKTVGTKIMKITPVTGVASDLSSLSVIMTATLIHLPVSTT
FT                   QVIDSSIMGVGTANHKKEVNWRTGKNMVVTWFITLPLAGLLAAVVYWISAAIFL"
     atggatacgg ttattttaat tacggttatt atcgttataa tgggcttagc atttgatttt        60
     ataaatggat ttcatgatat tgcaaatgct gtggccacaa gtatttcaac tagagcttta       120
     aaaccgcgag tggcaattgg aattgcggca gtcatgaatt ttctgggagc catttcgttt       180
     accggagtag ctgaatcgct caccaaaagt attgtagatc cattttcgct taataatgga       240
     gagtttgtcg ttttatgcgg cttaattgcg gcagtgattt ggaatttgat gacttggctt       300
     gttggcatgc ctagtagttc ctcgcatgcg cttatcggtg cgatagctgg ggcctccatc       360
     gcatcagcca gtagttttag cgtgcttaat tggtcaggat ttacaactat tattattgca       420
     ctcattatct cgccgattat cggttttaca gtaggttatt tgatttattc actctttaag       480
     catctttttc acgacaaaaa gcttgggaag atgaatcgac gctttcgttt tatccaaatt       540
     ggaacagctg ccgcccaagc atattcacac ggcacaaatg atgcccaaaa aacgatggga       600
     attatcacgc ttgctttagt tgcgagtggg cttttgaaag agtcagctgg tattcctttt       660
     tgggtgcaag taagttgtgc ggcatcgatg gcgattggat cgtctgttgg tggttatcga       720
     atcatcaaaa cagtaggaac taaaatcatg aaaatcaccc cagttacagg tgttgcgtcc       780
     gatttaagct cactttctgt aatcatgaca gctactttga ttcatttgcc agtcagcact       840
     acgcaagtta ttgacagctc gattatgggt gtcggaacag ctaaccataa aaaagaagtc       900
     aattggcgta cgggaaaaaa tatggttgta acttggttta tcacgttacc actagctgga       960
     cttttggcag cagtggtata ctggatatca gcagctattt ttttataa                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page