(data stored in ACNUC10821 zone)

EMBL: AE017262.PE420

AE017262.PE420       Location/Qualifiers
FT   CDS_pept        443347..443727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0426"
FT                   /product="glyoxalase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03210"
FT                   /protein_id="AAT03210.1"
FT                   /translation="MKIEHVALWTTNLEQMKQFYVTYFGATANDLYENKTKGFNSYFLS
FT                   FEDGARLEIMSRTDVTGKTTGENLGWAHIAISTGTKEAVDELTEKLRQDGFAIAGEPRM
FT                   TGDGYYESVVLDPEGNRIEITW"
     atgaaaatag aacatgttgc attatggaca actaatttag aacaaatgaa gcaattttac        60
     gtcacttatt ttggtgcaac ggccaatgat ttatatgaaa acaaaacaaa aggcttcaat       120
     tcttactttc tttcgtttga agacggagca agacttgaaa ttatgagtcg gacggatgta       180
     acaggaaaaa caactgggga aaacttaggc tgggcgcaca tcgctatttc aacaggaaca       240
     aaagaagcag tagatgagct aactgaaaaa ctaagacaag atggttttgc aattgcgggt       300
     gaaccaagaa tgacaggaga cggatactac gaaagtgtcg tgctagaccc agaaggcaat       360
     cgcatcgaaa ttacgtggta g                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page