(data stored in ACNUC10821 zone)

EMBL: AE017262.PE422

AE017262.PE422       Location/Qualifiers
FT   CDS_pept        444201..444623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0429; match
FT                   to protein family HMM PF07009"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03212"
FT                   /protein_id="AAT03212.1"
FT                   /translation="MRQYMKMVRPFDFVIIILLILGSFLPLILFSVAEAKHVGDDVVAV
FT                   ISQDGKVVREIPLTGHKGNEQFTIKGKGAQYNLMEVDGERIRIKEDNSPDQVGVKMGWK
FT                   SKAGDTIVCLPHKVFVEIKSTNKKSKDPDTDLIVPN"
     atgcgtcaat atatgaaaat ggtacgtccg tttgattttg taattattat tttactaatc        60
     ttgggttcgt ttttaccact aatattattt tctgtcgctg aagcaaagca cgtgggcgat       120
     gatgtcgtag cagttatttc acaagatggc aaagtggttc gggaaatccc gctaactggg       180
     cacaaaggaa atgagcagtt tacgattaaa ggaaaaggcg cgcaatataa tttgatggaa       240
     gtagatggcg agcggattcg aataaaagaa gacaacagtc cagaccaagt aggcgtcaaa       300
     atgggctgga aatccaaagc cggtgacacc attgtttgtt taccacataa agttttcgta       360
     gagataaaat cgacaaacaa aaaaagcaaa gaccccgata cagatttaat tgtgccgaat       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page