(data stored in ACNUC10821 zone)

EMBL: AE017262.PE424

AE017262.PE424       Location/Qualifiers
FT   CDS_pept        complement(447370..449973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0430"
FT                   /product="putative phosphoenolpyruvate synthase"
FT                   /note="identified by similarity to GP:2995397; match to
FT                   protein family HMM PF00391; match to protein family HMM
FT                   PF01326"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03214"
FT                   /protein_id="AAT03214.1"
FT                   /translation="MKPYVLKFQEIRPHSEALVGGKGMNLGACSNIEGVHVPAGFCLTT
FT                   EAYKRTLAENNEFTQLLQRLSSLKTSDMDAIREISETIRTLIQHTQIPSEIASYMDATL
FT                   LDVGGYEMPFAVRSSATAEDLPHASFAGQHDTYLNIIGKDALLQHISMCWASLFTERAI
FT                   IYRIQNQFDHRKVQLAVVIQQMISPEASGILFTADPITSNRKSLSIDASFGLGEALVSG
FT                   LVSADSYTVRENTITNKIIATKKLAIYSLKEGGTETRILEKSQQTKQTLTDQQIIQLAK
FT                   LGRKIEAYFGKPQDIEWCLAEGAFYIVQSRPITTLYPIPEVNEPGNRVYISVAHQQMMT
FT                   DAMKPLGLSFYLMTTPATMYTAGGRLFVDITQSLSAKVSRDMMVNSLGQSDPLIKDALL
FT                   TVINKKGFLPPLPTEENPSHATVSGKPPVRSIPDSSSVFELVRNSENSIKHLKQSIETK
FT                   SGSDLFDFIVEDLEELKRVLFNPTSIDAIMAGMDASAWLNEHIYQWLGEKNVADKLSES
FT                   APNNITSQMGLELLDVADVIRPYPAVRAYLEQTKNPDFMNELATLEGGAETKKALEDYL
FT                   QKYGMRCAGEIDLTKTRWIENPLTLIPLILSNIKNFDSGASMHKFAQGEKEAFHKEQEI
FT                   LRRLQELPDGEQKAMETKEKIDILRHFIGYREYPKYGMINRYFIYKLALLRAGEQLVKD
FT                   GILQEQEDIYFLYFEELREVVRTGQVDYELINVRKRDFATFEKLTPPRILTSDGEMING
FT                   EYKRENLPKDAILGLPVSSGTVEGRARVILDMEKADLEDGDILVTAYTDPSWTPAFVSI
FT                   KGLVTEVGGLMTHGAVIAREYGLPAVVGVENATTIIKDGQQIRINGTEGYIEILD"
     atgaaaccat atgtactcaa gtttcaagaa atacggccgc attcagaagc acttgtcggt        60
     ggtaaaggaa tgaatttagg tgcttgctct aatatcgaag gagtacatgt tcccgcaggt       120
     ttttgcctga caacagaagc ttacaagcga accttagcgg aaaacaatga atttacgcaa       180
     ctgctccaac gcctttcttc cctaaaaaca agtgacatgg atgctattag agaaatcagc       240
     gaaacgattc gaacgcttat tcaacataca caaatcccct ctgaaatagc gagttatatg       300
     gatgctacgc ttttagatgt gggtgggtat gagatgcctt tcgccgtacg ttctagcgcc       360
     actgccgaag accttcccca cgcttccttc gctgggcaac atgatacgta tttaaatatt       420
     attggtaaag atgccttatt acaacatatc agtatgtgct gggcttcttt gtttaccgaa       480
     cgcgcgatta tttatcgcat tcaaaatcag ttcgatcatc gtaaagtcca acttgccgtc       540
     gttattcaac aaatgatttc ccccgaagca tccggaatcc tatttacggc tgatccaatt       600
     acatcgaatc gcaaatccct ctctatcgat gccagtttcg ggctaggtga agcgcttgtt       660
     tccggtttag tttctgctga ctcatacaca gtccgagaaa atactattac gaacaaaata       720
     atcgctacta aaaaactcgc catttacagt ttaaaagaag gtggaacgga gactcgcata       780
     cttgaaaaat cacaacaaac caagcaaaca ttaactgacc aacaaataat acaacttgcg       840
     aaacttggta gaaaaatcga agcctatttt gggaaaccac aagatattga atggtgttta       900
     gcggaaggtg ctttttacat tgttcagagt cgacctatca cgactttata tccaattcca       960
     gaagtaaacg aacccggcaa tcgtgtttat atttctgttg cacatcagca aatgatgact      1020
     gacgcgatga aaccactggg actttccttt tatttaatga cgactcccgc cacgatgtat      1080
     acagcaggag ggcggttgtt tgtcgatatt actcagagcc tgtcagccaa agtttctcgc      1140
     gatatgatgg tcaattcact cggtcaatca gacccactta ttaaagatgc cttgctcact      1200
     gtaattaaca aaaaaggatt cctgcctcca ctaccaaccg aggaaaatcc aagccatgcg      1260
     accgtttctg gaaaaccacc cgtacgtagc attcctgatt catctagcgt ttttgaatta      1320
     gttcgaaaca gcgaaaactc cataaaacac ttgaagcaat ccatcgaaac gaaaagcgga      1380
     tctgatttgt ttgattttat cgtagaggat ttggaagaat taaagcgagt tttatttaat      1440
     cctactagta ttgatgccat tatggcaggt atggacgctt cagcttggtt aaatgaacat      1500
     atctaccagt ggctcggaga aaaaaatgtc gccgataaac tgtcagaatc agccccaaac      1560
     aatattactt cacaaatggg acttgaatta ttagatgtag ctgacgtcat tcgcccctac      1620
     cctgctgtca gagcctattt agaacaaacg aaaaaccctg atttcatgaa tgaactagct      1680
     actttagaag gtggtgcaga aaccaaaaaa gcgctagaag attaccttca aaaatacggg      1740
     atgcgctgtg cgggtgaaat tgacttaacc aaaactcgtt ggattgaaaa cccgctaacg      1800
     cttattccgc tgattttaag taacatcaaa aatttcgact ccggcgcgag tatgcacaaa      1860
     tttgcccagg gagaaaaaga agctttccat aaagaacaag aaatcctaag acgtttgcaa      1920
     gagcttccgg acggggaaca aaaagcgatg gaaacaaaag aaaaaatcga tattttacgt      1980
     catttcatcg gctatcgtga gtatcctaaa tatgggatga ttaatcgcta ctttatttac      2040
     aaactggctt tacttcgagc tggcgaacaa cttgtaaaag atggcattct gcaagagcaa      2100
     gaagatattt attttcttta ctttgaggaa ctgcgcgaag tcgtgcgtac tggtcaagtt      2160
     gattacgaac ttattaacgt tcgaaaacgt gatttcgcca cttttgaaaa attaacgcca      2220
     ccacgcatcc ttacttctga tggggaaatg attaacggcg aatacaaacg cgaaaatctc      2280
     cctaaagacg ccattcttgg acttccagtt tcatcaggga cagttgaagg tcgcgctcgc      2340
     gtcattttag atatggaaaa agcggattta gaagatggcg atattcttgt tacggcttat      2400
     actgacccta gttggactcc cgcatttgta tctattaaag gacttgtgac cgaggttggc      2460
     gggcttatga cgcacggagc agtgattgcg cgcgaatacg gccttcccgc tgtcgtgggt      2520
     gtcgaaaatg caactaccat tataaaagat ggccagcaaa ttcgcatcaa tgggacagaa      2580
     ggctatattg agattcttga ttaa                                             2604
//

If you have problems or comments...

PBIL Back to PBIL home page