(data stored in ACNUC10821 zone)

EMBL: AE017262.PE425

AE017262.PE425       Location/Qualifiers
FT   CDS_pept        complement(450173..451051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0431"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03215"
FT                   /protein_id="AAT03215.1"
FT                   /translation="MYMTGLGTLLFLVGIGVLIFGLVSFRRKNWPRKKTQIIIISSILA
FT                   IIIGVGIIPTTDEEASTEEPTKQEEKTEKVDNTPILKAETTFTTDDEGTLVVEGKTNPG
FT                   AEVTLDFVAIPDAVTTADENGAFSLSVNQLDKAQDAVLSIVIDGQTKEQTLKLALTPAY
FT                   ETKLTAKAEAERVAAEKAEAERVERERVAAEEKRAADAKIAAEKKAEEARVAAEKKAAE
FT                   EKRVAAERSKAAAAQPDTSNEQGQMVYITATGKRYHYDQNCRGLNNSNGETAVTVAQAK
FT                   AQGLTLCKFEQ"
     atgtatatga cgggattagg aactttattg tttctagtag gtattggtgt attgattttt        60
     ggactggtga gctttagaag gaaaaattgg cctcgtaaaa aaacacaaat cattattatt       120
     agttctattt tagctattat tattggtgtt ggaattattc cgaccacaga cgaggaagcc       180
     tcaactgaag aaccaaccaa acaagaagaa aaaacggaga aagttgataa taccccaatt       240
     ttaaaagcag aaacgacttt tacaacagat gatgaaggta ccttggtcgt cgaagggaaa       300
     acaaatccag gggcagaagt aacgcttgat ttcgttgcaa ttcctgacgc cgtgactaca       360
     gctgatgaga acggcgcttt cagtctttct gtaaatcaac tggataaagc acaagatgcc       420
     gttctttcta ttgtcattga tggccaaacg aaagaacaaa cgcttaaact agcactaacc       480
     cctgcttacg aaacaaaact tactgctaaa gcggaagcag agcgagtagc cgcggaaaaa       540
     gcggaagcag aacgagtaga acgcgaacgt gtagcagcgg aagaaaaacg cgcagctgat       600
     gcaaaaattg cggctgaaaa gaaagccgaa gaagctagag tggcagccga gaaaaaagct       660
     gcggaagaaa aacgggttgc agcagaacgt tcaaaagctg cagctgcaca accggacacg       720
     agtaacgaac aaggacaaat ggtttatatc actgctactg gcaaaagata tcattatgat       780
     caaaattgtc gcggcttaaa taactctaat ggcgaaactg ctgtgacagt tgctcaagca       840
     aaggcacaag gcttaacttt atgtaaattt gaacaataa                              879
//

If you have problems or comments...

PBIL Back to PBIL home page