(data stored in ACNUC10821 zone)

EMBL: AE017262.PE428

AE017262.PE428       Location/Qualifiers
FT   CDS_pept        452708..454108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0434"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by similarity to OMNI:NTL02SP1332; match
FT                   to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03218"
FT                   /protein_id="AAT03218.1"
FT                   /translation="MKIRWIRLSLVTVLIIAVVFVGVIGFQKYQFSKSRNKVIMQMDRL
FT                   MKDQDGGNFRRLDKKENGVEIISYIPKTTEKKDNEIIQKEIEKATDAEVKKLNRDKETQ
FT                   GIIFYTYQKHRMAEQAISYKAVQSEYVKEGRTKFVLKDKKDICKNIVTDAETGALLTLG
FT                   EVLIKSNQTKLNLKTAVEEELIKTGGFSLKDVGNLGEIKSLVKWNQTDFEITNSELILP
FT                   VKIPGAPEPNKVKVKLADIASSVNKRYLPSSVKVPEVPKAKTNKRIALTFDDGPSASVT
FT                   PGVLDTLKRHNVKATFFVLGSSVIQNPGLVKRELEEGHQVGSHSWDHPQLTKQSTQEVY
FT                   NQILKTQKAVFDQTGYFPTTMRPPYGAVNKQVAEEIGLPIIQWSVDTEDWKNKNAGIVT
FT                   KKVLAGATDGAIVLMHDIHKTTAASLDATLTKLKNQGYEFVTIDELYGEKLQIGKQYFD
FT                   KTDSRMVK"
     gtgaaaatta ggtggattag actttcacta gttaccgttc tcattattgc cgtggttttt        60
     gttggtgtaa taggtttcca aaaataccaa ttttcaaagt cgcgcaacaa agtaataatg       120
     cagatggaca gactaatgaa agaccaagat ggaggaaatt tccgccgctt ggataagaaa       180
     gaaaatggag tggaaatcat ttcttacatt cctaaaacaa ctgagaaaaa agacaacgaa       240
     attatccaaa aagaaattga aaaggccaca gatgcagagg ttaaaaagtt aaatagagat       300
     aaagaaactc aagggattat tttttacact taccaaaagc atagaatggc cgagcaagca       360
     atatcttata aagctgttca atcagagtac gtaaaagaag gtagaactaa atttgtactc       420
     aaagataaaa aagatatttg caaaaacata gtaaccgacg cagaaacagg tgctttgtta       480
     acacttgggg aagtattaat aaaaagtaat caaactaaat taaatttaaa aacagctgtt       540
     gaagaagaac tgattaaaac agggggtttt tctttaaaag atgttgggaa tcttggggaa       600
     attaagagtt tagtgaaatg gaatcaaaca gatttcgaaa ttacgaactc tgaactaatt       660
     ttgccagtaa aaataccagg tgcaccggaa ccgaataaag taaaagtaaa acttgctgat       720
     attgctagtt ctgtgaataa acgctactta ccaagcagtg tgaaagttcc agaagtgcca       780
     aaagcaaaaa ccaacaagcg aattgcgctt acttttgatg atggtccaag tgcctcggta       840
     acaccaggcg tacttgatac attgaaacgc cacaatgtaa aagcgacatt ctttgtactt       900
     ggctctagtg tcatacaaaa tccgggttta gtaaaacgtg aattagagga agggcaccaa       960
     gttggcagcc actcatggga tcacccgcaa ttaactaaac aatcgacaca agaagtgtac      1020
     aaccaaattt taaaaacgca aaaagcagta tttgatcaaa ctggatattt tccaactaca      1080
     atgcgccctc catatggtgc agtaaacaaa caggtggctg aagagattgg tcttccaata      1140
     attcagtggt ctgttgatac agaagattgg aaaaacaaaa atgctggtat agtaacgaaa      1200
     aaagtccttg ctggtgcaac ggacggagcg attgtactaa tgcatgatat tcataaaacc      1260
     actgctgcga gccttgacgc tacattgact aaattaaaga atcaaggata tgagtttgtt      1320
     actattgatg aactttatgg cgagaaattg caaattggga agcaatattt cgataaaaca      1380
     gattcaagaa tggtgaaata a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page