(data stored in ACNUC10821 zone)

EMBL: AE017262.PE429

AE017262.PE429       Location/Qualifiers
FT   CDS_pept        454235..454438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0435"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03219"
FT                   /protein_id="AAT03219.1"
FT                   /translation="MKVRNKVKQLREERGIGQNELALALEVSRQTIHAIEKGKYNPSLE
FT                   LSLKMARYFRLTIEEIFQLEEN"
     ttgaaagtcc gtaataaagt gaaacagctg cgggaagaaa gaggaatcgg acaaaatgaa        60
     ttagctttag cattagaagt ttcaagacaa acaatccatg ctattgaaaa aggtaaatat       120
     aatcctagtt tagagctaag tttgaagatg gcacgctatt ttcgtttaac aatagaagag       180
     atttttcaac tggaggagaa ttag                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page