(data stored in ACNUC10821 zone)

EMBL: AE017262.PE430

AE017262.PE430       Location/Qualifiers
FT   CDS_pept        454440..454850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0436"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03220"
FT                   /protein_id="AAT03220.1"
FT                   /translation="MKRYIINRGIMVAVVIIYMYPLLGIIKGEKIFGDIGTPIVMIIAA
FT                   LIGTLSSVFLSEEKTKREYEKEKLEKDERYINNRKTFSHYLLIVLALTIPIVLIVLNLN
FT                   GIEQISISSLTIIFLIFCFAYMIVLEIIRKKV"
     atgaaacgat acattattaa tcgaggtatt atggttgcgg tagttattat atatatgtat        60
     ccacttttag gaataattaa aggggaaaaa atatttggag atatcggtac accaattgtt       120
     atgattattg cggctttaat tggtacactg agttctgtat tcttatctga agaaaaaacg       180
     aagcgggaat atgagaaaga aaaactagaa aaagatgaaa gatatatcaa caatcgcaaa       240
     acattctccc attatttgct gattgtttta gctttgacga taccaattgt gttaattgtt       300
     cttaatttaa atgggattga acaaatctcc atttcgagtc tgacgattat ttttcttatc       360
     ttctgttttg cgtatatgat tgttctagaa attatccgaa aaaaagtatg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page