(data stored in ACNUC10821 zone)

EMBL: AE017262.PE432

AE017262.PE432       Location/Qualifiers
FT   CDS_pept        complement(455283..455837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LL0877; match
FT                   to protein family HMM PF06736"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03222"
FT                   /protein_id="AAT03222.1"
FT                   /translation="MSKGRLEAFSDGVFAIIITIIVLGMTLPDVFTAASTQAFLWEIFI
FT                   FIEGGLIIGQFWYSHSRLFDQVTFISTSAVLFNILFLLVLSLIPLFTRAIMQHPDMTAP
FT                   IIGFVITILITSVLFQLLHHAVNGKDSGIDNWKFRISSFIFVIMLGIISFFAPQISTIL
FT                   FIIFPIAGWIIQLTNRRQPPK"
     ttgtcaaaag gaagattaga agcatttagt gatggtgttt ttgcaattat aattacaatc        60
     attgttttag gaatgacttt accggatgta tttaccgcag ctagcacaca agcattctta       120
     tgggaaattt ttatatttat cgaaggcgga ttaattatcg gacaattttg gtattcacat       180
     agcaggctgt ttgatcaagt cacattcatt tccacatctg ccgtcttatt taatatttta       240
     tttttattag ttttgtcact tatcccatta tttacaagag caatcatgca acatccagat       300
     atgaccgcac cgattattgg atttgttatt actattttga ttacttcggt gctattccaa       360
     ttattgcatc acgcggtaaa tggaaaagat tcaggtatcg acaattggaa gtttcgaatc       420
     tctagtttca tatttgtaat catgcttggt attatcagtt tcttcgctcc acaaatatcc       480
     accattttat ttattatttt cccaatcgct ggttggatta ttcaactcac aaaccgccgt       540
     cagcctccaa aataa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page