(data stored in ACNUC10821 zone)

EMBL: AE017262.PE434

AE017262.PE434       Location/Qualifiers
FT   CDS_pept        complement(456815..457672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0440"
FT                   /product="putative sugar transporter"
FT                   /note="identified by similarity to GP:2226001; match to
FT                   protein family HMM PF06800"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03224"
FT                   /protein_id="AAT03224.1"
FT                   /translation="MSIYLIALLPVLGWGFMPIIANLRKSTPEEQLLGTSISALLFAFI
FT                   LFWILSPEITVLSFIVSFVSGIFWSFGQLLQFKGIAASSVAKAMPISNGTQLVGATLFA
FT                   VLVFREWQTVTAVIIGVVAVILILIGVVMTGFQKRGNHITESVSFHVYGIVILSSFFLT
FT                   LYVVTNQLFDVTGFSIILPQAIGMLTCAIGINLAKKTAISRKNVTFNLMTGLSWSIANL
FT                   GMFLATAVLGVATSFSISQACVIVATIGGILIFKQKKSPLEWTFILSGILLIMVGVVFL
FT                   SLLK"
     atgtctattt atcttattgc gttactccct gttcttgggt ggggatttat gccaataatt        60
     gcgaacttac gaaaaagcac ccccgaggaa caactactgg ggacttcgat tagcgcgcta       120
     ttatttgctt tcattttgtt ctggatttta tcaccagaaa taacggttct ttcttttata       180
     gtgagttttg tttcgggtat cttttggagt tttgggcaat tactgcagtt taaagggatt       240
     gcggcttcta gtgttgcgaa ggcaatgccg atttcaaacg gaactcagct agttggcgca       300
     acgctttttg ctgttcttgt tttccgggaa tggcaaacgg ttacggctgt tatcatcgga       360
     gttgttgcag taattttaat cttgattggg gtggtaatga ccgggtttca aaaacgcggg       420
     aatcatatca cggagtcggt ttcatttcat gtctacggta tcgttattct atcttctttc       480
     tttttaacgc tttacgtagt gacaaaccag ctttttgatg tcactggctt ttctatcatt       540
     ttaccacaag ccatcggtat gctgacatgc gccattggta ttaacttagc gaaaaagact       600
     gctatttccc gaaaaaatgt tacatttaac ttaatgaccg gattatcgtg gtcaatcgcc       660
     aatttaggca tgttcttagc gactgctgta cttggtgtcg caacgagctt ctcgatttca       720
     caagcttgcg ttatcgtcgc aacaatcggc ggtatcctca ttttcaaaca gaaaaaaagc       780
     ccgctagaat ggacttttat cctttctggc atactgttaa taatggtggg cgtcgtgttc       840
     cttagtttat tgaaataa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page