(data stored in ACNUC10821 zone)

EMBL: AE017262.PE436

AE017262.PE436       Location/Qualifiers
FT   CDS_pept        459796..460260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0442"
FT                   /product="PTS system, fructose-specific, IIA component"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM TIGR00848"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03226"
FT                   /protein_id="AAT03226.1"
FT                   /translation="MEVKDILTKELVVFDLEATTKEAAIEEMAEMLDEHGILADKATYV
FT                   RAVLDREAHSTTGIGNNIAIPHGKSESVTKSAIVFARTKEMIEWESLDDEPVNMIFLLA
FT                   ITDSDKTDGHLKILAEIATKLMDDDIVENLKNTRDEEEVIRILNGGVVEI"
     atggaagtaa aagatatttt aacaaaagaa ttagtcgtct ttgatttaga ggcgacgaca        60
     aaagaagcag caattgaaga aatggcagaa atgctagatg aacatggtat tttagcggat       120
     aaagcgactt atgttcgggc agttttggat cgcgaagcac attcaacaac tggaatagga       180
     aataacattg ctatcccaca cggaaaaagt gaaagtgtca caaaatcggc catcgttttt       240
     gcaagaacga aagaaatgat tgagtgggaa tcactggatg acgaaccggt aaatatgatt       300
     ttcttactgg cgattactga ttctgacaaa acagacggtc acttaaaaat ccttgcagaa       360
     attgcaacga aactaatgga cgatgatatt gtcgaaaatt taaaaaatac aagagacgaa       420
     gaagaagtta ttcgaatttt aaatggaggc gtagtagaga tatga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page