(data stored in ACNUC10821 zone)

EMBL: AE017262.PE437

AE017262.PE437       Location/Qualifiers
FT   CDS_pept        460257..460577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0443"
FT                   /product="PTS system, fructose-specific, IIB component"
FT                   /note="identified by match to protein family HMM PF02379;
FT                   match to protein family HMM TIGR00829"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03227"
FT                   /protein_id="AAT03227.1"
FT                   /translation="MKRKIIAVTACATGVAHTYMAAQALKKGAKKMGNLIKVETQGATG
FT                   IENELTEKDVNIGEVVIFAVDTKVRNKERFDGKVVLEVPVSAPIKDAEKVINAALALID
FT                   EK"
     atgaaacgta aaattatcgc agtaaccgca tgtgcgacag gagtggcgca cacatatatg        60
     gcagcacaag cacttaaaaa aggcgcgaaa aaaatgggca acctcattaa agtagaaaca       120
     caaggcgcaa caggaattga gaatgaatta accgaaaaag atgtaaatat cggcgaagta       180
     gttattttcg cagtagatac aaaagttcgt aacaaagaac gttttgatgg taaagtcgtg       240
     ctggaagttc cagtaagcgc accgattaaa gatgcagaaa aagtaatcaa cgcagcactt       300
     gcgttaattg acgaaaaata a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page