(data stored in ACNUC10821 zone)

EMBL: AE017262.PE438

AE017262.PE438       Location/Qualifiers
FT   CDS_pept        460590..461696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0444"
FT                   /product="PTS system, fructose-specific, IIC component"
FT                   /note="identified by match to protein family HMM PF02378;
FT                   match to protein family HMM TIGR01427"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03228"
FT                   /protein_id="AAT03228.1"
FT                   /translation="MFRKIGSELKKHVLTGISYMIPLVIAGAVIMAIARVGGSFFGITD
FT                   IWDAKYADSANSLISLLHSLDGFGGLALGMMFPVIAAFIGYSIADKLALAPGLVGGLLA
FT                   RDIGAGFLGALAAGLIAGYTCLLIKKYVKLPKAAASIVPVFLVPVFGTLITVLIINYVV
FT                   GIPFADLNTALENWLNGMSGSNQILMAAIIGAMVGFDLGGPVNKAAVTTAMALLTSGIY
FT                   APNTAAQVAIIIPPLGLGLATLIAKRKYNTEMREAGKSSLIMGLVGISEGAIPFAVESP
FT                   LKVIPATVLGSAVGGALAVGLGAINQAPISGFYGWFTVENWPVYILAIAVGTLIVAGMS
FT                   VALRKASAGEEMAGSSYDDEIDEAEWEA"
     atgttcagaa aaattgggag tgaactgaaa aaacacgttt taacaggtat ttcatatatg        60
     attccgctcg ttattgcagg cgccgtgatt atggcgattg ctcgggttgg tggttcgttt       120
     ttcggaatta cagatatttg ggatgcgaaa tacgcagaca gtgcgaatag tttaatttca       180
     ctactgcata gtttagatgg ttttggtggc ttggcgctag gaatgatgtt cccggttatt       240
     gcagcattta tcgggtattc gattgcggac aaattagcac tagcacctgg tcttgttggt       300
     ggtttactgg cacgtgatat tggcgctggt ttccttgggg cactggcagc tggtttaatc       360
     gctggttaca catgtctatt gattaaaaaa tacgtgaaac tgccaaaagc ggcggcttcg       420
     attgtaccgg tatttttagt accagttttt ggcacactta ttaccgttct tattattaat       480
     tatgtggttg gtattccttt tgctgactta aatacagccc ttgaaaattg gctaaatggt       540
     atgtctggat cgaatcaaat tctaatggcg gctattatcg gagcaatggt tggttttgac       600
     ttaggcggac ctgtaaataa agcagctgta acaacggcga tggcactttt aacaagtgga       660
     atttatgcac caaatacagc agcacaagta gcaatcatca tcccaccact tggtcttggt       720
     ttagcaacct taatcgcaaa acgtaaatat aatactgaaa tgcgtgaggc aggaaaatct       780
     tctcttatca tgggacttgt tgggattagt gaaggggcaa ttcctttcgc ggtagaatct       840
     ccgcttaaag ttattccggc tacggttctt ggttctgctg tcggcggcgc gctagctgta       900
     ggtcttggcg caattaacca agcgccaatt agtggttttt atggctggtt cacagttgaa       960
     aattggccag tttacatttt agcaattgca gttggaacgc taatcgttgc gggtatgtca      1020
     gtcgctttac gtaaagcaag tgctggcgag gaaatggctg gttcaagcta cgatgacgaa      1080
     attgacgaag cagaatggga agcttaa                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page