(data stored in ACNUC10821 zone)

EMBL: AE017262.PE439

AE017262.PE439       Location/Qualifiers
FT   CDS_pept        461712..464294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0445"
FT                   /product="glycosyl hydrolase, family 38"
FT                   /note="identified by match to protein family HMM PF01074;
FT                   match to protein family HMM PF07748"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03229"
FT                   /protein_id="AAT03229.1"
FT                   /translation="MVKAHIVNHTHWDREWYFTSADALVLSEQLFTEVIDELKKHPEAN
FT                   FVLDGQLSILDDYVALYPEKLADIKQLIADKQLFIGPWFTQTDAFFAHGESILRNAMIG
FT                   IFDSKKYGDYMEIGYLPDTFGFNAQMPTLLEHAGFDNVIFWRGIHLGEHVASPYFKWQG
FT                   LGEEASIYAINMPQGYGTGMLLEPTSAYVDGRLDPAIDFIEKYSKTTEVLIPSGNDQLN
FT                   IISNFAEKLVEINKMGRHDYQLSTYQDFIQYVRELPDLEEYRGEFRSPVLARVHKTIGS
FT                   SRMNIKLKSASLEQKLLTRIEPLLVIAKASGISISERLLMHTWKKLLEGQAHDSLAGCV
FT                   SDPVAEDILHRMKEADELCDSIENTIVKKIADDLSLAANEIIVFNTDLHDFDGYKEIQV
FT                   VTEHKNIHFPAFPDATIVQEEFIPSRENVLEETPAGNRFIEELGYYVLQVRVKVELPGL
FT                   GYRVIAFEENDRELDSMIASNDVAITNNFYKITFENGEIALEKPNGERITSFITLEDDV
FT                   NAGDTYDYSPLAGDIAELFTFSEVKTEKSSEVERLILTGKSDFPLDRLTKEGHGDLQIK
FT                   LILEVKKGSELLDVKVEVDNQIKNHRLRLKVNTGVKTDYNIASLPFGYIKRKPVVPANW
FT                   RETYSEMPIDIEPLEQSVTLTNEAESCTIFTQGIKEYQQLDQYLALTLLATTGQLGKPD
FT                   LAYRPGRASGDTTKKGHVLIETEGAQLLGKHEFSLAIYLGDQAFDEHKTAERTKAFNQA
FT                   NVSYQRQPFNHFLHRLDNKIQKTERKLGAKQTLGMLNLPKEYLVSACHPSYYSADKYII
FT                   RLENPTNTPQKLALSDMSFEYVNAIEEVVANDNNTIPAYGAVTLRLEI"
     atggttaaag cacatattgt gaaccatacg cattgggacc gagagtggta ttttacctcg        60
     gccgatgcac tggttctaag tgaacaactt tttacagaag taattgacga attaaaaaag       120
     cacccagaag caaactttgt acttgatggg caactgtcga ttttagatga ttatgtcgca       180
     ctgtacccgg aaaaattagc ggatattaag caattaattg cggataaaca acttttcatt       240
     ggaccgtggt ttacgcaaac agatgccttt ttcgcgcatg gtgagtcgat tttgcgcaat       300
     gcgatgattg ggatttttga tagtaaaaaa tacggcgact atatggaaat tggttatttg       360
     ccagatacat ttggttttaa tgcccaaatg ccgactttac ttgaacatgc tggctttgat       420
     aatgtgattt tctggcgtgg gattcatctt ggtgaacatg ttgcgtctcc atattttaaa       480
     tggcaaggac ttggagaaga agcgtcgatt tatgcgatta atatgccaca aggttacggc       540
     acagggatgc tccttgaacc aacctcggca tatgtggatg gacgcctcga cccggcaatt       600
     gatttcattg aaaagtacag taaaacaact gaagttttaa ttccatctgg gaatgatcag       660
     ctgaatatta ttagtaactt tgccgaaaaa ttagtggaaa tcaacaagat gggacgccat       720
     gattatcaac ttagtaccta tcaagatttt attcaatatg ttagagagct gcccgactta       780
     gaagaatatc gcggcgaatt tagaagtccg gttcttgcgc gagtgcataa aactattgga       840
     tctagccgaa tgaatattaa gctaaaaagc gcgtcactcg agcaaaaatt gctaactcgt       900
     attgagccac ttcttgttat tgctaaagca tctggaattt ctattagcga gcgtttacta       960
     atgcacactt ggaagaaact tttagaaggt caagcgcacg atagcttggc gggctgcgtt      1020
     tctgatccag ttgccgaaga tattttgcac cggatgaaag aagctgacga actatgcgat      1080
     agtatcgaaa acacgattgt gaaaaaaatt gccgatgatt tatcacttgc ggcgaacgaa      1140
     attatcgttt ttaacacgga tttacatgat tttgacggat ataaagaaat acaagtagta      1200
     accgagcata aaaacatcca tttcccagcg tttccggacg caacgattgt ccaagaagag      1260
     ttcattccat cgcgcgaaaa tgtgctagaa gaaacgccag ccggaaaccg atttattgaa      1320
     gaactgggct actatgtgct tcaagtgcgc gtcaaagtgg agcttccagg ccttggttac      1380
     cgcgtgattg cttttgaaga gaatgaccgc gaactggatt cgatgattgc ttccaatgat      1440
     gtggcaatca cgaataattt ctacaaaatc acttttgaaa atggcgaaat tgctcttgaa      1500
     aaaccaaacg gcgagcgcat cacttctttt attacactag aagatgatgt gaatgcggga      1560
     gatacgtatg attattcacc actagccgga gatatcgcgg aattattcac tttttccgaa      1620
     gtgaaaacgg agaaatcaag cgaagtcgaa cgtttaattt taacaggaaa aagcgatttc      1680
     ccacttgatc gtttgacgaa agaagggcat ggcgacctgc aaatcaaact cattttagag      1740
     gtgaaaaaag gtagcgaact gctggatgtt aaagttgaag tagataacca aattaaaaat      1800
     caccgtctac gcttaaaagt aaacacaggt gtgaaaacag actacaacat cgcttcactt      1860
     ccattcggat atatcaagag aaaaccagtt gtaccagcga attggcgaga aacatatagc      1920
     gaaatgccaa tcgacatcga accacttgaa caaagcgtga cgctaacaaa tgaagcagaa      1980
     agttgtacca ttttcacaca gggcatcaaa gaataccaac aattggatca atatttagca      2040
     ctgacgctac tggcaacaac cggacaactc ggaaaacctg atttagcata ccggccaggc      2100
     cgagcatcag gcgacacaac gaaaaaaggt cacgtgctca tagaaacaga aggcgcgcag      2160
     ttacttggta aacatgaatt ttcattagcc atttacctcg gggaccaagc tttcgatgaa      2220
     cataaaacag ctgaacgaac aaaagcgttc aaccaagcaa acgtatctta tcaacgccaa      2280
     ccgttcaatc actttttaca tcgcttggat aacaaaatcc agaaaacaga acggaaatta      2340
     ggcgcgaagc aaacgttagg tatgttgaat ttgccgaaag aatacttagt ttcagcgtgc      2400
     cacccgtcct actactcagc agataaatac attatccgcc tggaaaaccc aactaacaca      2460
     ccacaaaagt tggcactctc ggatatgtcg tttgagtatg tgaatgctat cgaagaagtt      2520
     gttgcaaatg acaacaacac gattccagca tatggcgctg ttacgttgcg attagaaata      2580
     tag                                                                    2583
//

If you have problems or comments...

PBIL Back to PBIL home page