(data stored in ACNUC10821 zone)

EMBL: AE017262.PE44

AE017262.PE44        Location/Qualifiers
FT   CDS_pept        47989..49374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0046"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02834"
FT                   /protein_id="AAT02834.1"
FT                   /translation="MEKKKKFRLFDAVLMAVCVVLVVESAAPAAAIGSSQFFWWIALLI
FT                   LFFLPYGLVSAELGTTYDDEGGIYDWVKRAFGRKWGARVAWLYWINYPIWMASLAVLFV
FT                   EVITQIFPVSFGTPVSIFIQLIFVWIVVIISCYPVSDSKWILNIAAFCKVAIMLCLGVL
FT                   GIYFAMTKGLANDFSGKALLPTFDLESLSFISVILFNFLGFEVVTTLASDMENPKKQIP
FT                   QAIIYGGVLIAFFYLLAAFGMGAAIPTSELSTSGGLIDSFIMLIGGVNPFVIIIGIMFM
FT                   YTLVANLVSWALGVNYVAMYAAKNKDLPAVFGKTNPKNDMPTGTSILNGIVASVLIVAA
FT                   PLIPNENIFWAFFALNVVALLGSYILMFPAFLKLRKVDPDRERPFKVPGGKILLYLMTF
FT                   VPMILLIITLIFSAVPLNGSSAELNEKIPILIGTVVAVIVGEICIWLAGKRKDKGEIGN
FT                   END"
     ttggaaaaaa agaagaaatt cagattattt gatgcggttc ttatggctgt atgtgtcgtt        60
     ttagttgtgg aatctgccgc gccagcagcg gcgataggat catctcaatt tttctggtgg       120
     attgcgttac ttattttatt tttcttacca tatggacttg tttcggcaga acttgggaca       180
     acctatgatg atgaaggcgg aatctatgat tgggtaaaac gggcatttgg ccgaaaatgg       240
     ggtgcgcgtg tcgcttggtt atactggatt aattatccga tttggatggc gagtttagcg       300
     gtattgtttg tagaagttat tacgcaaatt ttcccggttt catttgggac gccggtttcg       360
     atttttattc agctcatttt tgtgtggatt gttgttatta ttagttgtta tccagtgagt       420
     gatagcaaat ggattcttaa tatcgcagct ttctgtaaag tggcaattat gctttgcctt       480
     ggtgtacttg gaatttattt tgcgatgacg aagggattgg cgaatgattt ctctggaaaa       540
     gcattacttc caacttttga tttagagagt ttgtcattta tttcagtcat tttatttaat       600
     ttcttaggtt ttgaagtggt aacaacgctt gcgagtgaca tggaaaatcc taaaaaacaa       660
     attcctcaag caatcattta tggtggggtt ttgattgcat tcttctattt actagcagct       720
     ttcggaatgg gggcagcaat tccgacttct gaactttcaa catccggtgg tcttattgat       780
     agctttatta tgctgattgg cggagttaac ccatttgtta ttattattgg gattatgttt       840
     atgtatacat tagtagcaaa tttagtctct tgggcactag gcgtgaatta tgtagcaatg       900
     tatgcagcga aaaacaaaga tttaccagct gtttttggaa aaacaaatcc gaaaaatgat       960
     atgccaacgg gtactagtat tttaaatggg attgtagctt ctgtattaat cgttgcggca      1020
     ccacttattc caaatgaaaa tattttctgg gcattctttg cattaaatgt agttgcttta      1080
     ctaggttcat atatcctaat gtttccagca tttttgaaat tacgtaaggt ggatccggac      1140
     cgagaacgtc catttaaagt gccaggtggc aaaatcttgc tttacttaat gactttcgta      1200
     ccaatgattt tactcattat tactttgatt ttctctgcag taccattaaa tggttcaagt      1260
     gcagaattaa atgaaaaaat cccaatctta attggaaccg ttgtagcggt gattgttggt      1320
     gaaatatgta tttggcttgc tgggaaaaga aaagacaaag gagagatagg aaatgagaac      1380
     gattga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page