(data stored in ACNUC10821 zone)

EMBL: AE017262.PE440

AE017262.PE440       Location/Qualifiers
FT   CDS_pept        complement(464317..465192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0446"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03230"
FT                   /protein_id="AAT03230.1"
FT                   /translation="MELRVLNYFLTVAREKTISQAAEVLHLSQPTLSKQLKELEEELGV
FT                   TLFIRGNRSITLTEDGLYLANRGKEILSLVELTTSNLLQNETISGKIMIGAAETRGFEF
FT                   IGSMLHELREKHSDITFQLHSGNADDVLEKIEHGLLDFGLVINPVEKLQYEYLPLNIED
FT                   TWGILVNTKHSLAKKAVVTPSDIEANPIVVSNQSFIDNQLASWLGEHFEQLNVIGRYNL
FT                   LYNASLLAKENIASILCIDGIINTKNTNLKFIPFSPPLTAGISIVWKKNQTFSSASKEF
FT                   LRLIKKTCSK"
     atggagcttc gtgtgttgaa ttatttttta actgttgcac gtgaaaaaac gattagtcaa        60
     gcggcggaag tgcttcatct ttctcagcca acgctttcta aacaattgaa ggaacttgag       120
     gaagaactag gggtaacttt atttattcgt ggaaatcggt ctattacgtt aacagaggat       180
     gggctttatt tagctaatcg cgggaaagaa attttatctt tagtggagtt aactacttcg       240
     aatttacttc aaaatgagac gattagcgga aaaataatga ttggtgctgc tgaaacgaga       300
     ggatttgaat ttatcggtag catgttacat gaacttagag agaagcattc cgacattact       360
     tttcaattgc atagcggcaa tgcggatgat gttttagaaa aaattgagca cggtttacta       420
     gattttggtt tggtaattaa tcctgtggaa aaactacaat atgaatattt accacttaat       480
     atagaagata cttggggaat tttagtcaat acaaaacatt ctttagcgaa aaaagcggtt       540
     gtaactccta gtgatattga agctaatccg attgtcgttt ccaaccaatc tttcattgat       600
     aatcagctag ctagttggct tggagagcat tttgaacaat tgaatgtaat tggtagatat       660
     aatttactgt ataatgcctc tttgctcgct aaggagaaca tcgcaagtat tctttgtatt       720
     gatggtatta tcaatacaaa gaatactaac ctgaagttta tccctttttc gccgcctcta       780
     actgctggaa ttagtattgt gtggaagaag aatcaaactt tctccagtgc ttcgaaggaa       840
     tttttacgat taataaaaaa aacttgctca aaataa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page