(data stored in ACNUC10821 zone)

EMBL: AE017262.PE441

AE017262.PE441       Location/Qualifiers
FT   CDS_pept        465310..465879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0447"
FT                   /product="acetyltransferase, CysE/LacA/LpxA/NodL family"
FT                   /note="identified by similarity to SP:Q09707; match to
FT                   protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03231"
FT                   /protein_id="AAT03231.1"
FT                   /translation="MIEQDLQKRLVDQEILQGSDLLDEIHKVKQNNEQLIIELNTKYHS
FT                   KKEVIKYLSDITGKPVDPSVDVSLPFYSDFGKHITFGKNIFINLNVTFVDLGGITIEDN
FT                   VLIGPGARLVTVNHLVSPKKRRGLRVAPICVKKNAWIGANATILSGVTIGENAIVAADA
FT                   TVTRDVPANVIVAGSPAKQIRKIIEE"
     atgatagaac aagatttaca gaaaagacta gtcgaccaag aaattctcca agggtcggat        60
     ttgttagatg aaattcacaa agtaaagcaa aacaatgaac aacttatcat cgaactaaac       120
     accaagtacc actcaaaaaa agaagtgatt aaatatctca gtgacatcac tggaaaacca       180
     gtcgatccat cagtcgatgt ctcacttcct ttttatagcg acttcgggaa acatattact       240
     tttgggaaaa atatctttat caatttaaat gtaactttcg tggatttagg tgggattacg       300
     attgaagata atgttttaat tggcccagga gcaagacttg tgaccgttaa tcatttagtt       360
     agcccgaaaa aaagacgtgg actacgtgta gccccaattt gtgtgaagaa aaacgcctgg       420
     attggcgcaa acgcgacgat attatcaggc gtaacaatcg gcgaaaatgc tatcgttgct       480
     gcggatgcta ccgtcacaag agatgtccca gcaaacgtta tcgtcgccgg aagcccagcc       540
     aaacaaattc gtaaaattat cgaggaataa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page