(data stored in ACNUC10821 zone)

EMBL: AE017262.PE445

AE017262.PE445       Location/Qualifiers
FT   CDS_pept        474103..474585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0451"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03235"
FT                   /protein_id="AAT03235.1"
FT                   /translation="MLDKQQLYIVENKDIPNYEVDSGITGAEQNYIYNFKNPIPISEQE
FT                   LQDICDTFGEFMVSAYFLVDIFGPYEELPGDKKNGYKKVVLADESMEIKKKMFHLFLEG
FT                   DAYPDANKIFLFKEKKELNARKNMEIEDGMIVISPVLDVTAIGIFSKGIDLAQFFK"
     atgcttgaca aacaacaact atatattgta gaaaacaaag acatacctaa ttatgaagtt        60
     gactctggaa ttactggagc agaacaaaat tatatttata attttaaaaa tccaatccct       120
     atttctgaac aagaattaca agacatttgt gatacttttg gtgagtttat ggtttctgct       180
     tattttttag tggatatatt tgggccgtat gaggaattac ctggagacaa aaagaatggc       240
     tataaaaaag ttgttcttgc agatgaatct atggagataa agaaaaagat gtttcatttg       300
     tttttagaag gtgatgctta tccagacgca aacaaaatat ttttgttcaa ggagaaaaaa       360
     gaattaaatg ctagaaaaaa catggaaata gaagatggaa tgatagtgat ttctcctgtt       420
     ttagatgtta ctgctatagg catattttca aaaggaatag atttggcgca gtttttcaag       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page