(data stored in ACNUC10821 zone)

EMBL: AE017262.PE446

AE017262.PE446       Location/Qualifiers
FT   CDS_pept        474856..474969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0452"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03236"
FT                   /protein_id="AAT03236.1"
FT                   /translation="MDDEGRLDGTCWIKKEDILALRFGGSVEQDLMNKLKK"
     gtggatgacg aaggtcgatt agatggaact tgttggataa aaaaagaaga tattctagcc        60
     ctgcgtttcg gcggcagtgt agaacaagat ttgatgaaca aactaaaaaa ataa             114
//

If you have problems or comments...

PBIL Back to PBIL home page