(data stored in ACNUC10821 zone)

EMBL: AE017262.PE447

AE017262.PE447       Location/Qualifiers
FT   CDS_pept        475465..475815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0453"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03237"
FT                   /protein_id="AAT03237.1"
FT                   /translation="MYNASPSVGHLGMKSTIDRKKRSDLTFPLKPKRFLNIFKSEPMRE
FT                   KPGIMEYNKFIIVTKGVDIKTLLSGVSDLNRRENIEYFLVQNTIMTYQILEGEVINFYA
FT                   KDLGFLVDELAL"
     ttgtataatg ctagtccctc ggttgggcat ttagggatga aatccactat agatagaaag        60
     aagcgaagtg atctaacatt cccattaaag cctaagcgtt ttctaaacat ttttaagtca       120
     gaaccgatga gggaaaaacc tggaataatg gaatataaca aatttataat tgtaactaaa       180
     ggagtagata taaagacatt acttagcggg gtgtcagatc ttaatagacg cgaaaacatt       240
     gaatattttt tagtgcaaaa tacaatcatg acttaccaga ttctagaagg cgaagtaatc       300
     aatttctatg caaaagactt gggattttta gttgatgaat tagctttata g                351
//

If you have problems or comments...

PBIL Back to PBIL home page