(data stored in ACNUC10821 zone)

EMBL: AE017262.PE450

AE017262.PE450       Location/Qualifiers
FT   CDS_pept        477058..477666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0456"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03240"
FT                   /protein_id="AAT03240.1"
FT                   /translation="MGNQKQSIDYFEVKGIAKFRNKLHKAYKDLTFPGLDFPYCVPDKK
FT                   YSYLYFPLDAFENTKEGNRILSVLLLDKEKDIYFHSDVFGMFLTSWLLLGKLKIKSINE
FT                   WNGVFSENILTKGSRNPINLVDISPTIFLLDGSILIKFDRSSHLVIIGFSNKMEQMNSE
FT                   IRLSKDEVVDYFIKKDAADESEAEDFKQAYLKNYYSVSI"
     gtgggaaatc aaaaacaatc tattgattac tttgaagtta aagggattgc taaatttcga        60
     aataagttac ataaagccta taaagattta acttttccag ggctagactt cccctattgt       120
     gtacctgaca aaaaatatag ctatttatat ttcccattag atgcatttga aaatacgaaa       180
     gaaggcaatc gaattttatc cgtacttttg ttagataaag aaaaagatat atattttcac       240
     tcagatgttt ttggaatgtt tttaacaagt tggctattac ttggaaaact aaaaataaaa       300
     agtataaatg aatggaatgg ggtattcagc gagaacatcc tcacaaaagg atcaagaaat       360
     cccattaatt tagttgatat tagccctact atattcctgc tagatgggag tatattaata       420
     aaatttgatc gtagttctca tttagtcatc attggatttt ctaataaaat ggagcaaatg       480
     aatagtgaga ttcgactttc taaagatgaa gtggtagatt attttattaa aaaagatgca       540
     gcagatgaat cagaagcaga agattttaaa caagcatatt taaaaaacta ctattcagtg       600
     agcatttaa                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page