(data stored in ACNUC10821 zone)

EMBL: AE017262.PE456

AE017262.PE456       Location/Qualifiers
FT   CDS_pept        479903..480169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0462"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03246"
FT                   /protein_id="AAT03246.1"
FT                   /translation="MNLTEALTDVITSKELVERSDKILYVDENQQSINDNLSLEERELL
FT                   EDISAQWDLYLVNSYDIDTLQSLDFEKVKFPEAYLKEWYRQTI"
     atgaatctca ctgaggcact taccgatgta attacaagta aagaactggt tgaaaggtcg        60
     gataaaatac tatatgttga tgagaatcag cagtcaataa acgataatct atcattagaa       120
     gaaagagagt tactagaaga tatatcagca caatgggatt tatatctagt taattcgtat       180
     gatatcgata cactacagag tttggatttt gagaaagtta agttccctga agcatattta       240
     aaggagtggt atagacaaac aatctag                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page