(data stored in ACNUC10821 zone)

EMBL: AE017262.PE458

AE017262.PE458       Location/Qualifiers
FT   CDS_pept        481229..481894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0464"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03248"
FT                   /protein_id="AAT03248.1"
FT                   /translation="MKKLNYFSIGFDYDEEKNPIMSFDSQSHCISEMYSGAFKPMMTKE
FT                   TSCIDINCIPTGKKVDKSHHLDAIYRVYFENKLFDLNKFNDENDSEKKKIILELLHIGA
FT                   IEACRNLGLDKARFIEAYEKVKELDYQNNYYYKKPKSSPNRKQKAQIYIEHGLYKADIY
FT                   IVIFNKEQKIIRKEFILSDLPNPFVFSAHLGNLKWIDNDRLVLAHKQRKDILYKVDMI"
     atgaaaaaat taaactattt ttctataggt tttgattatg atgaagaaaa gaatccaatt        60
     atgtcatttg acagtcaaag ccactgtatt tcagaaatgt attcgggtgc atttaagcca       120
     atgatgacaa aagagacttc ttgtattgat attaattgta taccaacggg gaaaaaagtg       180
     gataaatctc atcacctcga tgccatttat agagtttatt ttgaaaataa gttgtttgat       240
     ttaaataagt ttaatgatga aaatgactcg gaaaagaaaa agatcatttt agaactgctt       300
     cacataggag ctatagaagc gtgtcgtaat ttgggcttag ataaggctag atttattgag       360
     gcatatgaaa aggtaaaaga attagactat caaaataatt actactataa aaaaccaaaa       420
     tccagcccaa atagaaaaca aaaagcacaa atttatattg agcatggctt atacaaagct       480
     gacatatata tcgttatttt taacaaggaa cagaaaatca taagaaaaga atttatcctc       540
     agtgatttac caaatccgtt tgtattttcc gcacacctag gaaatttaaa atggatagac       600
     aatgatcgtt tagttctagc tcataagcaa agaaaagata tattatacaa ggttgatatg       660
     atttaa                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page