(data stored in ACNUC10821 zone)

EMBL: AE017262.PE459

AE017262.PE459       Location/Qualifiers
FT   CDS_pept        complement(482137..482376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0465"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03249"
FT                   /protein_id="AAT03249.1"
FT                   /translation="MSNCYGIYKKSFINVNTKISKHKKYSEHNVYKVFLFSYSLKYKKA
FT                   MTISNVIVKTAITLDKNSSMPAPPHSHCKENKRR"
     atgagtaatt gttatggaat atacaaaaaa tcttttatta atgtaaacac aaaaattagt        60
     aaacataaaa aatatagtga gcataacgtg tacaaagtct ttttattttc atatagttta       120
     aaatataaaa aagcaatgac gattagcaat gttattgtaa aaaccgctat cacacttgat       180
     aaaaattcta gcatgcccgc tccccctcat tcacactgta aagaaaacaa acgtagataa       240
//

If you have problems or comments...

PBIL Back to PBIL home page