(data stored in ACNUC10821 zone)

EMBL: AE017262.PE461

AE017262.PE461       Location/Qualifiers
FT   CDS_pept        483006..483152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0467"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03251"
FT                   /protein_id="AAT03251.1"
FT                   /translation="MLKKTKKILNEIKTIIQQKPFDYEKAENLISELNLEEAPTRIGEH
FT                   LTS"
     atgctaaaaa aaacgaaaaa aattctcaat gaaattaaaa ctattatcca gcaaaaacct        60
     tttgattatg agaaggcaga aaatttgata agtgagttaa atcttgaaga ggcccccact       120
     agaattggag aacatcttac tagctag                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page